(data stored in ACNUC7421 zone)

EMBL: U81260

ID   U81260; SV 1; linear; genomic DNA; STD; PRO; 7679 BP.
XX
AC   U81260; X13200;
XX
DT   25-DEC-1996 (Rel. 50, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Salmonella typhimurium carbamoylphosphate synthetase small subunit (carA)
DE   and carbamoylphosphate synthetase large subunit (carB) genes, complete cds.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-7679
RX   DOI; 10.1111/j.1432-1033.1988.tb14299.x.
RX   PUBMED; 2843375.
RA   Kilstrup M., Lu C.D., Abdelal A., Neuhard J.;
RT   "Nucleotide sequence of the carA gene and regulation of the carAB operon in
RT   Salmonella typhimurium";
RL   Eur. J. Biochem. 176(2):421-429(1988).
XX
RN   [2]
RP   1-7679
RA   Lu C.D., Walthall D.A., Abdelal A.T.;
RT   "Complete nucleotide sequence of the carAB operon of Salmonella typhimurium
RT   LT2";
RL   Unpublished.
XX
RN   [3]
RP   1-7679
RA   Lu C.D., Walthall D.A., Abdelal A.T.;
RT   ;
RL   Submitted (04-DEC-1996) to the INSDC.
RL   Biology, Georgia State University, Atlanta, GA 30303, USA
XX
DR   MD5; f6aaff5cb3e4d1099e242f30c22a7135.
DR   EuropePMC; PMC24794; 10611359.
XX
CC   On Dec 24, 1996 this sequence version replaced gi:47645.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7679
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium"
FT                   /strain="LT2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:90371"
FT   gene            1154..2302
FT                   /gene="carA"
FT   CDS_pept        1154..2302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /product="carbamoylphosphate synthetase small subunit"
FT                   /db_xref="GOA:P14845"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14845"
FT                   /protein_id="AAB39255.1"
FT                   /translation="MIKSALLVLEDGTHFHGRAIGATGSAVGEVVFNTSMTGYQEIVTD
FT                   PSYSRQIVTLTYPHIGNVGTNKADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLNGMDLAKEVT
FT                   TAETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQ
FT                   TSAEEVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPLFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK"
FT   gene            2321..5593
FT                   /gene="carB"
FT   CDS_pept        2321..5548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /product="carbamoylphosphate synthetase large subunit"
FT                   /db_xref="GOA:P14846"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14846"
FT                   /protein_id="AAB39256.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAGDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNADFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSIDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLTEQGVTQEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATTMALNADATEKVTSVQEMHAQIKKS"
XX
SQ   Sequence 7679 BP; 1778 A; 2033 C; 2086 G; 1782 T; 0 other;
     aagcttccag ccgcatgacg tttgcaaatg gcgcgttgcg atcggcgtta tggctaaaaa        60
     cgaagaaaaa tgggctattt gacatgcggg atgtgctggg gctggatgta ttatagcgac       120
     taaatacctt cgtgatgtgg ttgtggtaat caagattaat tgattacaaa gggcaatata       180
     ttattgccct tttgtttttg cccccggtta ttcggtcaga taaatacgcc tttcaccatt       240
     catgtttcga cagtttcttc gcccacggca tgttctgccg ttgttttcgc gttaagaata       300
     gtccgtttaa agacatccgg gccaacggca tccatttgcg tgacgtaatt gccattacga       360
     taaatgcggt taattggccc ttcagacgca tcggtacggg tcattacgtt caacgggaaa       420
     aaattactgc ctgaactgac gttagtgata ttgaggcgag cgccttaccg tatcaaaagg       480
     cacctcgacc agactgataa gactgatatc catcggaggg ggagtgctgt tcctcggggg       540
     ggcgttttat ctcttttgct tcaataggtt ggctttttta tgctgtagtg aggctggttg       600
     tggtccaatc gtatgtgcct gtcttaaaga aaaagaagct ggatctttat atcgcgattg       660
     taattcttat tacattgtct taatttgctg ttttttgttg attttatgat gcatttgatt       720
     tgttttttat atttttaata tattgatttt taaaattttt ttgtcgttaa ctttcttgat       780
     tttgaatttt tatgcattta atggcattga tgactattaa gtgagttttt atcgttgttt       840
     tttgttgttt taatgtcaaa tttgaccatt tggtccactt tttatcatgc cagccagttt       900
     tttgcgaact caaggaagcg caagcgtttt ctatcgtaac ttagttgatc tttttgcctc       960
     ttaaacagaa taagttcctt ataatgtgca aaataacata aaaaacaccc tctttatgtt      1020
     gacttttatc cggcttaact tcagaatgcc gccgtttgcc agaaatccac gggtaagcaa      1080
     atttgcattg cttcatactg actgaatgaa ttaatatgca aataaagtga gtgaatattc      1140
     tctggagggt gttttgatta agtcagcgct attggttctg gaagacggaa cccattttca      1200
     cggtcgggcc attggggcaa cgggttcggc ggttggggaa gtcgttttca atacttcaat      1260
     gaccggttat caagaaatcg tcactgatcc ttcctattcc cgccaaatcg tcactcttac      1320
     ttatccccat attggtaatg tcggcaccaa taaagccgat gaagaatcct ctcaggttca      1380
     tgcgcaaggt ttagtgattc gcgatctgcc gttgattgcc agcaacttcc gtaacaccga      1440
     agacctgtct tcttacctca aacggcataa cattgtggcg attgctgata tcgatacccg      1500
     caagctgacc cgactgctgc gtgagaaagg cgcacagaac ggctgcatca ttgcaggcga      1560
     tagcccggat gcgaagctgg cgctggaaaa agcgaaagca tttcctggac ttaacggtat      1620
     ggatctggcg aaagaagtga ccacggcgga aacttaccgc tggacgcagg gtagctggac      1680
     gctgaaagac ggtttaccgg aagcgaaatc tgaggatgac ctgccgttcc atgtggtggc      1740
     ctatgatttc ggcgcgaagc gcaacatcct gcgtatgctg gtggatcgcg gctgccgcct      1800
     gacggtggtg ccagcgcaaa cctctgctga agaggtgctg aaaatgaatc cggacggcat      1860
     cttcctgtca aacggccctg gcgacccggc tccgtgcgac tacgcgatta ctgctatcca      1920
     gaaattcctc gaaaccgaca ttccgctatt tggcatctgc ctcggtcatc agctactggc      1980
     gctggcgagc ggtgcgaaga ccgttaagat gaagttcggc catcacggcg gcaaccatcc      2040
     ggtaaaagat atggacagaa acgtggtaat gatcaccgcg cagaaccacg gctttgcggt      2100
     ggatgaagac tcgctgcccg ccaacctgcg cgtgacccac aagtcgctgt tcgacggcac      2160
     cctgcaaggg attcaccgta ccgacaaacc ggcgttcagc ttccagggcc acccggaggc      2220
     gagccccggc ccgcacgatg cggcgccgct gttcgaccac tttatcgagc ttattgagca      2280
     ataccgtcag tccgcgaaat aatcaggagt aataagagcc atgccaaaac gtacagatat      2340
     aaaaagcatc ctgattctgg gcgcgggccc gattgttatc ggtcaggcgt gtgagtttga      2400
     ctactccggc gctcaggcgt gtaaagccct gcgcgaagag ggctatcgcg tcattctggt      2460
     gaactccaac ccggccacca tcatgaccga cccggaaatg gccgatgcca cctacatcga      2520
     gccgattcac tgggaagtgg tgcgcaaaat cattgaaaaa gagcgtccgg atgcggtgct      2580
     gccgaccatg ggcggccaga ccgcgctgaa ctgcgcgctg gagctggagc ggcagggcgt      2640
     gctggaagag ttcggcgtca ccatgattgg tgcgaccgcc gacgccggtg ataaagccga      2700
     agaccgtcgt cgcttcgata tcgcgatgaa gaaaattggt ctcgacaccg cgcgttccgg      2760
     tatcgcgcac actatggaag aagcgctggc ggttgccgct gacgtgggct tcccgtgcat      2820
     catccggcct agctttacca tgggcggcac cggcggcggt atcgcttaca accgtgaaga      2880
     gttcgaagaa atctgcgaac gcggtctgga cctctcgcca accaacgagc tgctgattga      2940
     tgaatcgctg atcggctgga aagagtacga gatggaagtg gtgcgtgata aaaacgacaa      3000
     ctgcatcatc gtctgctcta tcgaaaactt cgatgcgatg ggtatccaca ccggtgactc      3060
     catcaccgtg gccccggcac agacgctgac cgacaaagaa taccaaatca tgcgtaacgc      3120
     ctcgatggcg gtactgcgtg aaatcggcgt cgaaaccggc ggttctaacg tccagttcgc      3180
     agtgaacccg aaaaacggcc gtctgatcgt tatcgaaatg aacccgcgcg tatcccgctc      3240
     ctcggcgctg gcgtcgaaag ccaccggttt cccgattgcc aaagtggccg cgaaactggc      3300
     ggtaggttac acccttgacg aactgatgaa cgacatcacc ggcgggcgca ctccggcctc      3360
     cttcgagccg tccatcgact atgtggttac taaaattccg cgctttaact ttgagaaatt      3420
     cgccggtgcc aacgaccgtc tgaccaccca gatgaaatcg gtcggagaag tgatggcgat      3480
     tggccgcacg cagcaggaat ccctgcaaaa agcgctgcgc ggcctggaag tcggcgccac      3540
     cggttttgac ccgaaagtga gcctcgacga cccggaagcg ctgaccaaaa tccgccgcga      3600
     gctgaaagac gcgggcgcag atcgtatctg gtacatcgcc gatgctttcc gcgcaggcct      3660
     ctccgtcgat ggcgtcttta acctgaccaa catcgaccgc tggttcctgg tgcaaattga      3720
     agagctggtg cgtctggaag agaaagtggc tgaagtcggg attactggcc tcaacgccga      3780
     cttcctgcgt cagctcaagc gtaaaggttt tgccgatgcg cgtctggcaa aattggcggg      3840
     cgtgcgcgag gcggaaatcc gcaaactgcg cgaccagtat gacctgcacc cggtctacaa      3900
     gcgtgtggat acctgcgcgg cggaattcgc caccgacacc gcctatatgt actccactta      3960
     tgaagatgag tgcgaagcga acccgtccat tgaccgcgat aaaatcatgg tcctcggcgg      4020
     cggcccgaac cgtatcggcc agggtatcga atttgactac tgctgcgtac acgcctcgct      4080
     ggcgctgcgc gaagacggtt acgagaccat tatggtcaac tgtaacccgg aaaccgtctc      4140
     caccgactac gacacttccg accgtctgta cttcgagccg gtcacgctgg aagacgtgct      4200
     ggaaatcgtg cgcatcgaga agccgaaagg cgttatcgtg cagtacggcg gccagacgcc      4260
     gctgaagctg gcgcgcgcgc tggaagcggc aggtgtgccg gtaatcggca ccagcccgga      4320
     cgccatcgac cgcgcggaag accgcgagcg cttccagcac gcggttgacc gtctgaagct      4380
     gaagcaaccg gccaacgcca ccgtcaccgc cattgaacag gctgtcgaaa aagcgaaaga      4440
     gatcggctac ccgctggtgg tacgtccttc ttacgtgctg ggcggtcggg cgatggaaat      4500
     tgtctatgac gaagccgacc tgcgtcgcta cttccagacg gcggtcagcg tctctaacga      4560
     tgcgccggtg ctgctggacc gcttccttga tgacgcggtt gaagtggacg tggacgctat      4620
     ctgcgacggc gaaatggtgc tgattggcgg cattatggag cacattgagc aggcgggcgt      4680
     acactccggc gactccgcct gttccctgcc ggcctacacg ctgagccagg aaattcagga      4740
     cgtgatgcgc cagcaggtgc agaagctggc cttcgagttg caggtgcgcg gcctgatgaa      4800
     cgtgcagttt gcggtcaagg acaacgaagt ctacctgatt gaagtcaacc cgcgtgcggc      4860
     gcgtaccgta ccgttcgtct ccaaagccac cggcgttccg ctggcgaaag tggcggcgcg      4920
     cgtgatggcc ggcaaatcgc tgaccgagca gggcgtgacc caagaaatta tcccgccgta      4980
     ctactcggtg aaagaagtgg tgctgccgtt caacaaattc cccggcgttg acccgctgtt      5040
     agggccagaa atgcgctcca ccggggaagt gatgggcgtg ggccgtacct tcgcggaagc      5100
     gttcgctaag gcgcagctgg gcagtaactc caccatgaag aaacagggcc gtgcgctgct      5160
     ctccgtccgc gaaggcgaca aagagcgcgt ggtggatctc gccgccaagc tgctgaaaca      5220
     gggctttgag ctggatgcca cccacggtac ggcgattgtg ctgggcgaag ccggtatcaa      5280
     cccgcgtctg gtgaacaagg tgcacgaagg tcgtccgcac attcaggacc gtatcaagaa      5340
     tggcgaatat acctatatta tcaacaccac cgcaggtcgc cgcgcgattg aagactccag      5400
     ggtgattcgc cgcagcgcgc tgcagtataa agtgcattat gacaccacgc tgaacggcgg      5460
     ttttgccacg acgatggcgc tcaatgccga tgccaccgag aaggtaacct cggtgcagga      5520
     aatgcacgcg cagatcaaaa agtcgtaaac aaagggtccg gcggatattg ctctaaccgg      5580
     acctgtaata taatgttgaa agggtttctg taaagaaacc ctttttttat cttgcgtaag      5640
     gtcattcctg gagaagtccg tttccgtaac cacattttca atgtaataag cacgatattg      5700
     ctcacactaa tcaatattta agtcgcatac tatcttgcat atccacaatt ttaatatggc      5760
     ttagttttta ttagtttgga caggccgtag ccagattttt aatttgtgaa atggtgtgct      5820
     tatgtgtgaa aaatatgttg aaagaccgct ttatttgtta attgctgact ggatgatggc      5880
     agagaaccga tggatcactg ccagggagat ttcccgtcaa tttgatattg aacattgcaa      5940
     agcaattaat acgctctcct atattctgtc agaagtgggg gaaattgttt gtgaagtgaa      6000
     gatgatccct aaccaaattg caggacgagg ctgccagtgc cagcgtctgg tgaaagtcgt      6060
     gagtatcgac tctcaactct atcgccgatt gaatcataat ttgcaggaaa gaaaagtgag      6120
     cgtggcgaaa gcgccgcggc tgtctgccgt tccccccaca gagctaaacc gtgagcagaa      6180
     atggcagatg atgctctcca agagtatgcg tcgctaattg tctgtttacc tgctggcggg      6240
     gtaaacggta attgacgcgt aggccggata agcgtgagcg catccggcat caattactgt      6300
     gctgattttg gcttcacgtc cgtcgtgcct ttcaggcgcg gtcggttttc ttcggcctgc      6360
     gttaacggct tcgtttcaga taaccccgtt cgacaacgga tcgcaagatc ctgatattct      6420
     ttggtattga ggtgtttcca gtgcagctcc tggtccgtaa cctggcgtag tacgcgcgcc      6480
     ggtgatccca ccaggagttg ccttgcctca ccctgaaatc cggctttgac aaaactcatg      6540
     gcggcgacaa tgctctcttc gccaatcact gcgccgtcca taatgacgct attcatgccg      6600
     accagggcgt cccgtcccac cacgcagcca tgtaaaatag cgccgtggcc gatatggccg      6660
     ttttcatgca cgatggtatc ggtatcgcag tagccatgca taatgcagcc atcctgcaga      6720
     ttagagcctg cctccaggat caggcgacca taatccccac gcaatgacgc gagtgggcca      6780
     atataaacac cggcgcccac gatgacatcg ccaatcagca cggcgctggg gtggacaaac      6840
     gcgtccggat gcaccaccgg gatcagtcct tcaaaggcgt aatagctcat agttgtacct      6900
     cggttttttg ccggatggcg gcgtaaacac cttatccggt ctacggttgc gcatgtgctg      6960
     taggccggat aagcgaagcg cccatccggc atagtcacat taacgacctt tccacaccgg      7020
     atcgcgtttt tcggcaaatg cctgcggtcc ttcgagcgca tcttctgaat gcagcaccga      7080
     cggataatgc ttcagtacgc cgctgcggat gtagcggtag ccttcttcta ccggcatttc      7140
     gctggtcgcg cgataaatct ctttcagcgc cgcgatagcc agcggggcgc tattgaccag      7200
     ttgttgcgcc agttcgcgcg cactctccat cagttcgctc tggctgacaa cgcggttcac      7260
     gactccccaa cgcagcgctt cttcggcgct cattcgtctg ccggtcatta ccatttcgtt      7320
     gacgatagcc ggtggcagca gcttaggcag acgcaatacg ccgccgctgt caggcacgat      7380
     gccgagcttg gcttccggca gcgcgaagct ggcgttttcg gcgcagacaa taaagtccgc      7440
     cgccagcgcc agctcaaaac cgccgccaaa cgcgtagccg ttcaccgcgg cgataaccgg      7500
     cttatcgagg tcaaatattt cggttaaacc ggcaaagccg ccgggaccaa aatcggcatc      7560
     cggcgcttca ccttccgctg ccgcttttaa gtcccagcca gcagaaaaga atttctcccc      7620
     gccgccggta atgattgcta cgcgtaattc cggatcgtca cggaaattaa gaaaagctt       7679
//

If you have problems or comments...

PBIL Back to PBIL home page