(data stored in ACNUC16935 zone)

EMBL: U84967

ID   U84967; SV 1; linear; genomic DNA; STD; PLN; 912 BP.
XX
AC   U84967;
XX
DT   13-JAN-1998 (Rel. 54, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana ubiquitin (UBQ11) gene, complete cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-912
RX   DOI; 10.1023/A:1005848828368.
RX   PUBMED; 9278165.
RA   Sun C.W., Griffen S., Callis J.;
RT   "A model for the evolution of polyubiquitin genes from the study of
RT   Arabidopsis thaliana ecotypes";
RL   Plant Mol. Biol. 34(5):745-758(1997).
XX
RN   [2]
RP   1-912
RA   Sun C.-W., Griffen S., Callis J.;
RT   ;
RL   Submitted (13-JAN-1997) to the INSDC.
RL   Mol. & Cell. Biol., UC-Davis, Davis, CA 95616, USA
XX
DR   MD5; 2de4e29e30e9828e638a2f4a5f1d74d9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..912
FT                   /organism="Arabidopsis thaliana"
FT                   /cultivar="ecotype Be-01-912"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..>912
FT                   /codon_start=1
FT                   /gene="UBQ11"
FT                   /product="ubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:O49976"
FT                   /protein_id="AAB95250.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLADYNIQKESTLHLVLRLRGG"
XX
SQ   Sequence 912 BP; 246 A; 221 C; 236 G; 209 T; 0 other;
     atgcagattt tcgttaagac tctcaccgga aagacaatca ccctcgaggt ggaaagctct        60
     gacaccatcg acaacgttaa ggccaagatc caggataagg agggtattcc tccggaccag       120
     cagaggctta tcttcgccgg gaaacagcta gaggatggcc gcacgttggc tgattacaat       180
     atccagaagg aatccaccct ccacttggtc ctcaggctcc gtggtggtat gcagattttc       240
     gtcaaaaccc taacgggaaa gacgattact cttgaggtgg agagctctga caccattgac       300
     aacgtcaaag ccaagatcca agacaaagag ggtattcctc cagaccagca gagattgatc       360
     ttcgctggaa agcaacttga agatggcaga actttggctg actacaacat tcagagggag       420
     tccacacttc acttggtctt gcgtctgcgt ggaggtatgc agatcttcgt gaagactctc       480
     accggaaaga ctatcacttt ggaggtagag agctctgaca ccattgacaa cgtcaaggcc       540
     aagatccagg ataaggaagg tatccctccg gatcagcaga ggttgatctt cgctggaaaa       600
     cagttggagg atggtcgtac cttggctgat tacaacattc agaaggagtc tacccttcat       660
     ttggtgttgc gtctgcgtgg aggtatgcag atcttcgtca agactttgac cggcaagacc       720
     atcactcttg aagttgagag ctccgacacc attgacaacg tgaaggctaa gattcaggac       780
     aaggaaggta ttcctccgga ccagcagcgt ctcatcttcg ctggaaagca gcttgaggat       840
     ggacgtactt tggccgacta caatatccag aaggagtcta ctcttcactt ggtcctccgt       900
     ctccgtggtg gt                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page