(data stored in ACNUC1829 zone)

EMBL: U89772

ID   U89772; SV 1; linear; mRNA; STD; MUS; 1641 BP.
XX
AC   U89772;
XX
DT   10-JUL-1998 (Rel. 56, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus PETA-3 (CD151) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1641
RX   DOI; 10.1016/S0167-4781(98)00034-7.
RX   PUBMED; 9602068.
RA   Fitter S., Seldin M.F., Ashman L.K.;
RT   "Characterisation of the mouse homologue of CD151 (PETA-3/SFA-1); genomic
RT   structure, chromosomal localisation and identification of 2 novel splice
RT   forms";
RL   Biochim. Biophys. Acta 1398(1):75-85(1998).
XX
RN   [2]
RP   1-1641
RA   Fitter S.;
RT   ;
RL   Submitted (17-FEB-1997) to the INSDC.
RL   Haematology, I.M.V.S, Frome Road, Adelaide, SA 5000, Australia
XX
DR   MD5; 4119f449e2970968e156dc3a1a9df794.
DR   Ensembl-Gn; ENSMUSG00000025510; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033234; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033216; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033148; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033217; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032931; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033728; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032261; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032903; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033055; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033008; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033150; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033041; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033748; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031965; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032372; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000058746; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106000; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177840; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087636; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087723; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087658; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087678; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087241; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088182; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087769; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087183; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087378; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087222; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087410; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087261; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088480; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087168; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086279; mus_musculus_wsbeij.
DR   EuropePMC; PMC2395240; 18184438.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1641
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        83..844
FT                   /codon_start=1
FT                   /gene="PETA-3"
FT                   /product="PETA-3"
FT                   /db_xref="GOA:O35566"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1096360"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35566"
FT                   /protein_id="AAC25976.1"
FT                   /translation="MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASSTYLATAYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQD
FT                   WQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
FT   polyA_site      1600..1605
FT                   /gene="PETA-3"
XX
SQ   Sequence 1641 BP; 380 A; 441 C; 428 G; 392 T; 0 other;
     tcagctcaga gtcctcacaa actgtccctt agggtggcct gagctctctg ccatatctgg        60
     gaacgggtat gagtggccca ggatgggtga attcaatgag aagaaggcaa catgtggcac       120
     agtctgcctc aagtacctgc tctttaccta caactgctgc ttctggctgg ccggcctggc       180
     tgtcatggca gtgggcatct ggacactggc cctcaagagt gactacatta gtctgctggc       240
     ctcaagcact tacctagcca cggcctacat cttagtggtg gctggtgttg ttgtcatggt       300
     gactggagtc ctgggctgct gtgccacttt caaggagcga cggaacctgt tacgcttgta       360
     cttcatcctg ctcctcatca tcttcctcct ggagatcatt gctggcatcc tggcctatgt       420
     ctattatcag cagctgaaca cagagctcaa ggagaatctg aaggacacca tggtcaagag       480
     ataccaccag tcaggccacg agggtgtgag cagcgctgtc gacaagctgc agcaagagtt       540
     ccactgttgt ggcagcaaca actctcaaga ctggcaagac agcgagtgga tccgctctgg       600
     tgaggcagac agccgcgtgg ttcctgacag ctgctgtaag actatggtag ctggctgtgg       660
     taagcgggac catgcctcca acatctataa agtggagggt ggctgtatca ctaagctgga       720
     gaccttcatt caggagcacc tgcgggtcat tggggcggtg ggcattggca tcgcctgtgt       780
     gcaggtcttc ggcatgatct tcacctgctg cttgtaccga agcctcaagc tggaacacta       840
     ctgaccacga tgatgtcagg ccgggcggcc agccttgcac tactgaccac gatgatgcca       900
     ggctgggcgg ccagccttgc actatgtccc agccccacta ctgaacacta ctgacttaga       960
     ctgctgactg ccagaggtag ctaccctcat gccatcgcca tgaccccccc tggcatgcca      1020
     cctcaggggc atgcaccttc aagtgccttt cactgcacac caaagtccca aagctcgaag      1080
     cagcgtactt gccccagcat taagaagggg gggggggtgg ggggttcaaa tgccagtgtt      1140
     gggctaggcc tggctagtag aatagggttt agattatttg acagaagtgc ctcttatgca      1200
     gactgcttcc ctttgggtag ctgtgatctg cagtaagtct ggggagaacc tgagtacacc      1260
     actacacgtt gggtaaaagc aggtggggcc tttctggttg gattaggcac ccttcatgcc      1320
     tgctaccagg aactctcaga tctgcttgcc ccaaacaaat ggtgtaagct gagggaaact      1380
     ccaaccccac acttgatgct ctgtcctctc cacacaggcc tcttgctcct aacagctcag      1440
     ccctggcctt ttctcactac tgatagcatc atgtaaatgc tccatgttcc tgtacactgt      1500
     ctccttttgg agcatctctg aatggagcat ggctgttttc atctcactgc tgtattccag      1560
     atgctgccca caaatgctcc tgctatgtaa caggtgctca ataaatgtaa atgtataaaa      1620
     aaaaaaaaaa aaaaaaaaaa a                                                1641
//

If you have problems or comments...

PBIL Back to PBIL home page