(data stored in ACNUC8465 zone)

EMBL: U93030

ID   U93030; SV 1; linear; mRNA; STD; MUS; 1623 BP.
XX
AC   U93030;
XX
DT   18-JUL-1997 (Rel. 52, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus MAP kinase kinase 7 mRNA, alternatively spliced, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1623
RX   DOI; 10.1073/pnas.94.14.7337.
RX   PUBMED; 9207092.
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   "Mitogen-activated protein kinase kinase 7 is an activator of the c-Jun
RT   NH2-terminal kinase";
RL   Proc. Natl. Acad. Sci. U.S.A. 94(14):7337-7342(1997).
XX
RN   [2]
RP   1-1623
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   ;
RL   Submitted (12-MAR-1997) to the INSDC.
RL   Program in Molecular Medicine, Howard Hughes Medical Institute and
RL   University of Massachusetts Medical School, 373 Plantation Street,
RL   Worcester, MA 01605, USA
XX
DR   MD5; 00151e2f0e1c89e7b5bcea05ad588df5.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
DR   EuropePMC; PMC116085; 9891090.
DR   EuropePMC; PMC23822; 9207092.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1623
FT                   /organism="Mus musculus"
FT                   /strain="CD-1"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10-12 week old"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        281..1321
FT                   /codon_start=1
FT                   /product="MAP kinase kinase 7"
FT                   /function="specific activator of the c-Jun NH2-terminal
FT                   kinase (JNK)"
FT                   /note="protein kinase; MKK7; alternatively spliced; see
FT                   alternative MKK7b mRNA in GenBank Accession Number U93030"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAB63447.1"
FT                   /translation="MLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEIN
FT                   DLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCP
FT                   YIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEK
FT                   HGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPT
FT                   KPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQ
FT                   SFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQH
FT                   HLPFFR"
XX
SQ   Sequence 1623 BP; 414 A; 476 C; 417 G; 316 T; 0 other;
     ggaaaggcag cctcctgtag gtgaaaattc tgttcactac ctggccacct ggcctgactg        60
     accttcacag cttgatcatc ttcctgaaga ggcattcagg attccctcca tccctacccc       120
     ttctggacaa agtcttccac gtttccttcc tgggagtttc ttccaggaac tggagatacc       180
     cagagccctg caactcccac tggccaacga tgggggcagc cgctcaccat cctcagagag       240
     ctccccacag caccctacac cccccacccg gccccgccac atgctggggc tcccatcaac       300
     cttgttcaca ccgcgcagta tggagagcat cgagattgac cagaagctgc aggagatcat       360
     gaagcagaca gggtacctga ctatcggggg ccagcgttat caggcagaaa tcaatgactt       420
     ggagaacttg ggtgagatgg gcagtggtac ctgtggtcag gtgtggaaga tgcggttccg       480
     gaagacaggc cacatcattg ctgttaagca aatgcggcgc tctgggaaca aggaagagaa       540
     taagcgcatt ttgatggacc tggatgtagt actcaagagc catgactgcc cttacatcgt       600
     tcagtgcttt ggcaccttca tcaccaacac agacgtcttt attgccatgg agctcatggg       660
     cacatgtgca gagaagctga agaaacgaat gcagggcccc attccagagc gaatcctggg       720
     caagatgact gtggcgattg tgaaagcact gtactatctg aaggagaagc atggcgtcat       780
     ccatcgcgat gtcaaaccct ccaacatcct gctagatgag cggggccaga tcaagctctg       840
     tgactttggc atcagtggcc gccttgttga ctccaaagcc aaaacacgga gtgctggctg       900
     tgctgcctat atggctcccg agcgcatcga ccctccagat cccaccaagc ctgactatga       960
     catccgagct gatgtgtgga gcctgggcat ctcactggtg gagctggcaa caggacagtt      1020
     cccctataag aactgcaaga cggactttga ggtcctcacc aaagtcctac aggaagagcc      1080
     cccactcctg cctggtcaca tgggcttctc aggggacttc cagtcatttg tcaaagactg      1140
     ccttactaaa gatcacagga agagaccaaa gtataataag ctacttgaac acagcttcat      1200
     caagcactat gagatactcg aggtggatgt cgcgtcctgg tttaaggatg tcatggcgaa      1260
     gaccgagtcc ccaaggacta gtggagtcct gagtcagcac catctgccct tcttcaggta      1320
     gcctcatggc agcggccagc cccgcagggg ccccgggcca cggccaccga cccccccccc      1380
     aacctggcca acccagctgc ccatcagggg acctgggacc tggacgactg ccaaggactg      1440
     aggacagaaa gtagggggtt cccatccagc tctgactccc tgcctaccag ctgtggacaa      1500
     aagggcatgc tggttcctaa tccctcccac tctggggtca gccagcagtg tgagccccat      1560
     cccaccccga cagacactgt gaacggaaga cagcaggcca aaaaaaaaaa aaaaaaaaaa      1620
     aaa                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page