(data stored in ACNUC8465 zone)

EMBL: U93031

ID   U93031; SV 1; linear; genomic DNA; STD; MUS; 1465 BP.
XX
AC   U93031;
XX
DT   18-JUL-1997 (Rel. 52, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Mus musculus MAP kinase kinase 7 mRNA, alternatively spliced, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1465
RX   DOI; 10.1073/pnas.94.14.7337.
RX   PUBMED; 9207092.
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   "Mitogen-activated protein kinase kinase 7 is an activator of the c-Jun
RT   NH2-terminal kinase";
RL   Proc. Natl. Acad. Sci. U.S.A. 94(14):7337-7342(1997).
XX
RN   [2]
RP   1-1465
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   ;
RL   Submitted (12-MAR-1997) to the INSDC.
RL   Program in Molecular Medicine, Howard Hughes Medical Institute and
RL   University of Massachusetts Medical School, 373 Plantation Street,
RL   Worcester, MA 01605, USA
XX
DR   MD5; 5ce9603013a38a8dc7d3916108a11df6.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
DR   EuropePMC; PMC23822; 9207092.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1465
FT                   /organism="Mus musculus"
FT                   /strain="CD-1"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="10-12 week old"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..1172
FT                   /codon_start=3
FT                   /product="MAP kinase kinase 7"
FT                   /function="specific activator of the c-Jun NH2-terminal
FT                   kinase (JNK)"
FT                   /note="protein kinase; MKK7b; differs in the 5' region from
FT                   the alternately spliced form of MKK7 mRNA found in GenBank
FT                   Accession Number U93030"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAB63448.1"
FT                   /translation="TSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPTRPRHML
FT                   GLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQV
FT                   WKMRFRKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVF
FT                   IAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLD
FT                   ERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGIS
FT                   LVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPK
FT                   YNKLLEHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR"
XX
SQ   Sequence 1465 BP; 374 A; 434 C; 386 G; 271 T; 0 other;
     gcacgagccc tgctcctgcc ccgtcccagc gagcagccct gcaactccca ctggccaacg        60
     atgggggcag ccgctcacca tcctcagaga gctccccaca gcaccctaca ccccccaccc       120
     ggccccgcca catgctgggg ctcccatcaa ccttgttcac accgcgcagt atggagagca       180
     tcgagattga ccagaagctg caggagatca tgaagcagac agggtacctg actatcgggg       240
     gccagcgtta tcaggcagaa atcaatgact tggagaactt gggtgagatg ggcagtggta       300
     cctgtggtca ggtgtggaag atgcggttcc ggaagacagg ccacatcatt gctgttaagc       360
     aaatgcggcg ctctgggaac aaggaagaga ataagcgcat tttgatggac ctggatgtag       420
     tactcaagag ccatgactgc ccttacatcg ttcagtgctt tggcaccttc atcaccaaca       480
     cagacgtctt tattgccatg gagctcatgg gcacatgtgc agagaagctg aagaaacgaa       540
     tgcagggccc cattccagag cgaatcctgg gcaagatgac tgtggcgatt gtgaaagcac       600
     tgtactatct gaaggagaag catggcgtca tccatcgcga tgtcaaaccc tccaacatcc       660
     tgctagatga gcggggccag atcaagctct gtgactttgg catcagtggc cgccttgttg       720
     actccaaagc caaaacacgg agtgctggct gtgctgccta tatggctccc gagcgcatcg       780
     accctccaga tcccaccaag cctgactatg acatccgagc tgatgtgtgg agcctgggca       840
     tctcactggt ggagctggca acaggacagt tcccctataa gaactgcaag acggactttg       900
     aggtcctcac caaagtccta caggaagagc ccccactcct gcctggtcac atgggcttct       960
     caggggactt ccagtcattt gtcaaagact gccttactaa agatcacagg aagagaccaa      1020
     agtataataa gctacttgaa cacagcttca tcaagcacta tgagatactc gaggtggatg      1080
     tcgcgtcctg gtttaaggat gtcatggcga agaccgagtc cccaaggact agtggagtcc      1140
     tgagtcagca ccatctgccc ttcttcaggt agcctcatgg cagcggccag ccccgcaggg      1200
     gccccgggcc acggccaccg accccccccc caacctggcc aacccagctg cccatcaggg      1260
     gacctgggac ctggacgact gccaaggact gaggacagaa agtagggggt tcccatccag      1320
     ctctgactcc ctgcctacca gctgtggaca aaagggcatg ctggttccta atccctccca      1380
     ctctggggtc agccagcagt gtgagcccca tcccaccccg acagacactg tgaacggaag      1440
     acagcaaaaa aaaaaaaaaa aaaaa                                            1465
//

If you have problems or comments...

PBIL Back to PBIL home page