(data stored in ACNUC18020 zone)

EMBL: X00182

ID   X00182; SV 1; linear; genomic DNA; STD; VRT; 5046 BP.
XX
AC   X00182;
XX
DT   06-DEC-1983 (Rel. 04, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Gallus gallus cytoplasmic beta-actin gene
XX
KW   actin; beta-actin.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-5046
RX   DOI; 10.1093/nar/11.23.8287.
RX   PUBMED; 6324080.
RA   Kost T.A., Theodorakis N., Hughes S.H.;
RT   "The nucleotide sequence of the chick cytoplasmic beta-actin gene";
RL   Nucleic Acids Res. 11(23):8287-8301(1983).
XX
DR   MD5; ad5fbd8d057016428545c92561af6f13.
DR   CABRI; LMBP 2766.
DR   CABRI; LMBP 3585.
DR   EPD; EP07061; GG_ACTB.
DR   Ensembl-Gn; ENSGALG00000009621; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000015673; gallus_gallus.
DR   EuropePMC; PMC2772368; 19776194.
DR   EuropePMC; PMC3177952; 21476867.
DR   EuropePMC; PMC3508843; 23116495.
DR   EuropePMC; PMC3769739; 24031353.
DR   EuropePMC; PMC4330307; 25560830.
DR   EuropePMC; PMC4534708; 26141544.
DR   EuropePMC; PMC6580946; 30971474.
XX
CC   The nucleotide sequence codes for a protein which is identical
CC   to the bovine beta-actin, to human fibroblast beta-actin, and
CC   to the protein sequence predicted by the nucleotide sequence
CC   of the rat beta-actin gene.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5046
FT                   /organism="Gallus gallus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9031"
FT   regulatory      455..459
FT                   /regulatory_class="CAAT_signal"
FT   regulatory      517..524
FT                   /regulatory_class="TATA_box"
FT   precursor_RNA   544..4766
FT                   /note="putative primary transcript"
FT   precursor_RNA   544..4764
FT                   /note="putative primary transcript"
FT   intron          544..1542
FT   misc_RNA        544..544
FT                   /note="cap site"
FT   CDS_pept        join(1543..1665,1986..2225,2750..3188,3495..3676,
FT                   4032..4175)
FT                   /product="beta-actin"
FT                   /db_xref="GOA:P60706"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="PDB:3J0S"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60706"
FT                   /protein_id="CAA25004.1"
FT                   /translation="MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV
FT                   GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL
FT                   LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTV
FT                   PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD
FT                   FEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNS
FT                   IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERRYSVW
FT                   IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
FT   exon            1543..1665
FT                   /number=1
FT   intron          1666..1985
FT                   /number=1
FT   exon            1986..2225
FT                   /number=2
FT   intron          2226..2749
FT                   /number=2
FT   exon            2750..3188
FT                   /number=3
FT   intron          3189..3494
FT                   /number=3
FT   exon            3495..3676
FT                   /number=4
FT   intron          3677..4031
FT                   /number=4
FT   exon            4032..4172
FT                   /number=5
FT   intron          4173..4766
FT                   /number=5
FT   regulatory      4744..4751
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4764..4764
FT   polyA_site      4766..4766
XX
SQ   Sequence 5046 BP; 939 A; 1306 C; 1565 G; 1236 T; 0 other;
     caccggtgtt attgctgctc ggtgcgtgca tgcacatcag tgtcgctgca gctcagtgca        60
     tgcacgctca ttgcccatcg ctatccctgc ctctcctgct ggcgctcccc gggaggtgac       120
     ttcaagggga ccgcaggacc acctcggggg tggggggagg gctgcacacg cggaccccgc       180
     tccccctccc caacaaagca ctgtggaatc aaaaaggggg gaggggggat ggaggggcgc       240
     gtcacacccc cgccccacac cctcacctcg aggtgagccc cacgttctgc ttcactctcc       300
     ccatctcccc cccctcccca cccccaattt tgtatttatt tattttttaa ttattttgtg       360
     cagcgatggg ggcggggggg gggggggcgc gcgccaggcg gggcggggcg gggcgagggg       420
     cggggcgggg cgaggcggag aggtgcggcg gcagccaatc agagcggcgc gctccgaaag       480
     tttcctttta tggcgaggcg gcggcggcgg cggccctata aaaagcgaag cgcgcggcgg       540
     gcgggagtcg ctgcgttgcc ttcgccccgt gccccgctcc gcgccgcctc gcgccgcccg       600
     ccccggctct gactgaccgc gttactccca caggtgagcg ggcgggacgg cccttctcct       660
     ccgggctgta attagcgctt ggtttaatga cggctcgttt cttttctgtg gctgcgtgaa       720
     agccttaaag ggctccggga gggccctttg tgcggggggg agcggctcgg ggggtgcgtg       780
     cgtgtgtgtg tgcgtgggga gcgccgcgtg cggcccgcgc tgcccggcgg ctgtgagcgc       840
     tgcgggcgcg gcgcggggct ttgtgcgctc cgcgtgtgcg cgaggggagc gcggccgggg       900
     gcggtgcccc gcggtgcggg ggggctgcga ggggaacaaa ggctgcgtgc ggggtgtgtg       960
     cgtggggggg tgagcagggg gtgtgggcgc ggcggtcggg ctgtaacccc cccctgcacc      1020
     cccctccccg agttgctgag cacggcccgg cttcgggtgc ggggctccgt gcggggcgtg      1080
     gcgcggggct cgccgtgccg ggcggggggt ggcggcaggt gggggtgccg ggcggggcgg      1140
     ggccgcctcg ggccggggag ggctcggggg aggggcgcgg cggccccgga gcgccggcgg      1200
     ctgtcgaggc gcggcgagcc gcagccattg ccttttatgg taatcgtgcg agagggcgca      1260
     gggacttcct ttgtcccaaa tctggcggag ccgaaatctg ggaggcgccg ccgcaccccc      1320
     tctagcgggc gcgggcgaag cggtgcggcg ccggcaggaa ggaaatgggc ggggagggcc      1380
     ttcgtgcgtc gccgcgccgc cgtccccttc tccatctcca gcctcggggc tgccgcaggg      1440
     ggacggctgc cttcgggggg gacggggcag ggcggggttc ggcttctggc gtgtgaccgg      1500
     cggggtttat atcttccctt ctctgttcct ccgcagccag ccatggatga tgatattgct      1560
     gcgctcgttg ttgacaatgg ctccggtatg tgcaaggccg gtttcgccgg ggacgatgcc      1620
     ccccgtgctg tgttcccatc tatcgtgggt cgccccagac atcaggtacg gcaacggctg      1680
     cggtgctgca tccggacgat agggaggagc gttcggtggg agtggttctg ctgagggcag      1740
     cgagcctcaa gaagcccttt tattttcata tgtgacataa ggagtttctg tcctcaacag      1800
     taatgggttg agtacgcagc ctccgcggag catcctgtgt tggagcagtt gctcagtccc      1860
     ttccctgaca gagtagggac agtggggggt tggtaattaa aggtgtggca cttggaaaga      1920
     aaactttatt tgtccgttgg agttgatcct tcagttaaac ttaaagcttt ttctttgttg      1980
     tgcagggtgt gatggttggt atgggccaga aagacagcta cgttggtgat gaagcccaga      2040
     gcaaaagagg tatcctgacc ctgaagtacc ccattgaaca cggtattgtc accaactggg      2100
     atgatatgga gaagatctgg caccacactt tctacaatga gctgagagta gcccctgagg      2160
     agcaccctgt gctgctcaca gaggctcccc tgaaccccaa agccaacaga gagaagatga      2220
     cacaggtgtg taaaactctt tgagcctaga gctacagcag gtactgctgc aggccagctt      2280
     tcctcttcca tgttgtcctc tatctgcctt caccacttct ccctttttgc catctttaca      2340
     gggttttcct ttcctgacct gagtctcctc tttgctggac cttgacaggt tttgtttgct      2400
     ctaagctggc tttctctgag actgaactag caacttgtct aactgctgtt tctgactaga      2460
     cactaatcca tttaccatct ttgagtgact ataccgtagt ttcttggcct ttgtttcgtt      2520
     ccttgctgtg tcatgtggat gggcctgtgg tagcagtgtc cttgctcagg ctctgacttg      2580
     acaggtgtgg gtggagacca agtgagataa gtgctcatag ctccttctag aggagcagag      2640
     aagcctctta tctagggaca aatgtaaacc acatgcatgg accgatgtag gtgtgcagtg      2700
     agaaccttgg tttattctgc ttgactcagt gcttttttta tctttctaga tcatgtttga      2760
     gaccttcaac accccagcca tgtatgtagc catccaggct gtgctgtccc tgtatgcctc      2820
     tggtcgtacc actggtattg tgatggactc tggtgatggt gttacccaca ctgtgcccat      2880
     ctatgaaggc tacgccctcc cccatgccat cctccgtctg gatctggctg gccgtgacct      2940
     gacggactac ctcatgaaga tcctgacaga gagaggctac agcttcacca ccacagccga      3000
     gagagaaatt gtgcgtgaca tcaaggagaa gctgtgctac gtcgcactgg atttcgagca      3060
     ggagatggcc acagctgcct ctagctcttc cctagagaag agctatgaac tccctgatgg      3120
     tcaggtcatc accattggca atgagaggtt caggtgcccc gaggccctct tccagccatc      3180
     tttcttgggt aagtctgact cctttgagga gattccatgc cccttctgcc tagagcgact      3240
     tagagactgg ccacaatatt gctggccctt agcaggtctg tcccattcca ctgcagtctt      3300
     ttttcttcct cagtttgagg atgattgagg tacctaggtc agtagaacag gaggctgagc      3360
     ctgtcagcca tgcctttgtc tgtgttgttt cccactatgg ggtgtttgat tctcttgttt      3420
     tcccatagca gtaggtcctc tgtcttcctt gtccctgaac catttactga cttgacactg      3480
     ctttttgctt gcaggtatgg agtcctgtgg tatccatgaa actaccttca actccatcat      3540
     gaagtgtgat gtggatatcc gtaaggatct gtatgccaac acagtgctgt ctggtggtac      3600
     cacaatgtac cctggcattg ctgacaggat gcagaaggag atcacagccc tggcacctag      3660
     cacaatgaaa atcaaggtag gctggagccc taggctgctc ttagcacacc tcttaatgct      3720
     gagtgggtgg aggaggctga gctaaactac tacagaagat ggaaactgct ttgtcttagt      3780
     ggtggagcct tatggcctcg ctctgggcag ggtggcagcc actcagccat gtgagtaatg      3840
     agattaagtg ctggctgtga gttggggtgg gagggggagg gtgctgtgtg tagggctgtg      3900
     ccttaagcct gctcagactc tggagtgcct tggccaaggc ctgataaagg aattaggtag      3960
     cggagcgcca cagggctgcg tgtgggttgt gtaccatcac actgcatctg accagttgtt      4020
     ctctcctgca gatcattgcc ccacctgagc gcaggtactc tgtctggatt ggaggctcta      4080
     tcctggcctc cctgtccacc ttccagcaga tgtggatcag caagcaggag tacgatgaat      4140
     ccggaccctc cattgtccac cgcaaatgct tctaaaccgg actgttacca acacccacac      4200
     ccctgtgatg aaacaaaacc cataaatgcg cataaaacaa gacgagattg gcatggcttt      4260
     atttgttttt tcttttggcg cttgactcag gattaaaaaa ctggaatggt gaaggtgtca      4320
     gcagcagtct taaaatgaaa catgttggag cgaacgcccc caaagttcta caatgcatct      4380
     gaggactttg attgtacatt tgtttctttt ttaatagtca ttccaaatat tgttataatg      4440
     cattgttaca ggaagttact cgcctctgtg aaggcaacag cccagctggg aggagccggt      4500
     accaattact ggtgttagat gataattgct tgtctgtaaa ttatgtaacc caacaagtgt      4560
     ctttttgtat cttccgcctt aaaaacaaaa cacacttgat cctttttggt ttgtcaagca      4620
     agcgggctgt gttccccagt gatagatgtg aatgaaggct ttacagtccc ccacagtcta      4680
     ggagtaaagt gccagtatgt gggggaggga ggggctacct gtacactgac ttaagaccag      4740
     ttcaaataaa agtgcacaca atagaggctt gactggtgtt ggtttttatt tctgtgctgc      4800
     gctgcttggc cgttggtagc tgttctcatc tagccttgcc agcctgtgtg ggtcagctat      4860
     ctgcatgggc tgcgtgctgg tgctgtctgg tgcagaggtt ggataaaccg tgatgatatt      4920
     tcagcaagtg ggagttggct ctgattccat cctgagctgc catcagtgtg ttctgaagga      4980
     agctgttgga tgagggtggg ctgagtgctg ggggacagct gggctcagtg ggactgcagc      5040
     tgtgct                                                                 5046
//

If you have problems or comments...

PBIL Back to PBIL home page