(data stored in ACNUC7421 zone)

EMBL: X00847

ID   X00847; SV 1; linear; genomic DNA; STD; PRO; 441 BP.
XX
AC   X00847;
XX
DT   13-JUN-1985 (Rel. 06, Created)
DT   23-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Bacillus subtilis 0.3 kb gene
XX
KW   inverted repeat; sporulation; URF.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-441
RX   DOI; 10.1016/0022-2836(84)90493-5.
RX   PUBMED; 6205155.
RA   Stephens M.A., Lang N., Sandman K., Losick R.;
RT   "A promoter whose utilization is temporally regulated during sporulation in
RT   Bacillus subtilis";
RL   J. Mol. Biol. 176(3):333-348(1984).
XX
DR   MD5; 03bb49f051d6fbcfb28db70c820b9f47.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..441
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   repeat_region   15..23
FT                   /note="inverted repeat"
FT   repeat_region   51..58
FT                   /note="inverted repeat"
FT   precursor_RNA   115..>441
FT                   /note="primary transcript"
FT   regulatory      160..169
FT                   /note="SD-sequence"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176..361
FT                   /transl_table=11
FT                   /gene="orf"
FT                   /note="0.3 kb gene"
FT                   /db_xref="GOA:P37549"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37549"
FT                   /protein_id="CAA25403.1"
FT                   /translation="MGRRRGVMSDEFKYELAKDLGFYDTVKNGGWGEIRARDAGNMVKR
FT                   AIEIAEQQMAQNQNNR"
FT   misc_feature    372..393
FT                   /note="pot. stem-loop structure"
FT   repeat_region   372..379
FT                   /note="inverted repeat"
FT   repeat_region   385..393
FT                   /note="inverted repeat"
XX
SQ   Sequence 441 BP; 123 A; 72 C; 108 G; 138 T; 0 other;
     ctcagtggca ttttaacggg cagtgaacct tttgtttact gctttttgtt ttgccctttt        60
     ttggtttcca ataattttaa cgaaagttcc atctgattta acaaaagata aaacagtcac       120
     atattatcgt gacgtgcacg aatggctatc acttctaaaa aaggagttgt ttcgtttggg       180
     cagacgtcgt ggagttatgt cagatgagtt taaatatgag ctggctaaag accttggttt       240
     ttatgacaca gtaaaaaatg gaggctgggg tgaaattcgg gcccgcgatg ccggtaacat       300
     ggtgaagcgt gctattgaaa tcgccgaaca gcaaatggct cagaatcaga ataaccgata       360
     aggatgtgac ccgggggacg tgctgttccc tggttttttt attttggata taaatacata       420
     atgggctgaa tatggatatg t                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page