(data stored in ACNUC18020 zone)

EMBL: X02648

ID   X02648; SV 1; linear; genomic DNA; STD; VRT; 2620 BP.
XX
AC   X02648; K02255; M10279;
XX
DT   07-NOV-1985 (Rel. 07, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 9)
XX
DE   Chicken gene for type 5 nonmuscle actin
XX
KW   actin.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-2620
RX   PUBMED; 4000121.
RA   Bergsma D.J., Chang K.S.S., Schwartz R.J.;
RT   "Novel chicken actin gene: third cytoplasmic isoform";
RL   Mol. Cell. Biol. 5(5):1151-1162(1985).
XX
RN   [2]
RX   PUBMED; 6513927.
RA   Chang K.-S.S., Zimmer W.E.Jr., Bergsma D.J., Dodgson J.B., Schwartz R.J.;
RT   "Isolation and characterization of six different chicken actin genes";
RL   Mol. Cell. Biol. 4(11):2498-2508(1984).
XX
DR   MD5; 6781084f354eee13d959a42ea447be19.
DR   EPD; EP11079; GG_ACT5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2620
FT                   /organism="Gallus gallus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9031"
FT   regulatory      481..485
FT                   /regulatory_class="CAAT_signal"
FT   regulatory      523..530
FT                   /regulatory_class="TATA_box"
FT   precursor_RNA   556..2560
FT                   /note="put. primary transcript"
FT   exon            556..596
FT                   /number=1
FT   misc_RNA        556..556
FT                   /note="put. cap site"
FT   intron          597..1024
FT   mRNA            1025..2560
FT                   /note="exon 2"
FT   CDS_pept        1033..2163
FT                   /note="put. type 5 nonmuscle actin"
FT                   /db_xref="GOA:P53478"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53478"
FT                   /protein_id="CAA26486.1"
FT                   /translation="MADEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM
FT                   VGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV
FT                   LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHT
FT                   VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVAL
FT                   DFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEAIFQPSFLGMESCGIHETTFN
FT                   SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV
FT                   WIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
FT   misc_feature    2532..2538
FT                   /note="put. polyadenylation signal"
FT   polyA_site      2560..2560
FT                   /note="put. polyadenylation site"
XX
SQ   Sequence 2620 BP; 530 A; 715 C; 778 G; 597 T; 0 other;
     ggatccgact ctcccaaacc acccggaggg ccgggaccga acggcccaca gcccgctgcg        60
     cgccaacggc ggaaccccgc tccgcgccac ccagagacct tcggagcccg acggccgcgg       120
     ccctccacct ccgtaccccc cttaccgacc tcagaacggc caaaaccgcc ctccccccgc       180
     cttctgagag cttccgtaac ctccacggag gcttcgggac cgtttacctg cggcgggccc       240
     cgggcgcggt ggctgccgcc ctgctggcgc gccgcctcgg ctctgcccgc agtacagcgc       300
     aacgcagcac agccgctgcc cgccccgggc gccccgcctc agcccggccg gaaacggcgc       360
     gcggggggcg gcgccagtaa cggaagcgct cgcctcactt ccgggtacag gcccagcaac       420
     agaaaggaag ggcgcagcgg aaggagagag aaagaggcgg gagtggaggg agaacgatag       480
     ccaatgaaac ggcgaagtga gcagccgctt ccggttccgg ggatagaaaa gagggagcgc       540
     ggggtggggc cgagcacttg cgggtgagac agcattcggg tggagttgtc gtgcaggtga       600
     gggctgaggt gatgttgggc cttcgcgttg ctcctcgtgt ttttgctgct ctctttgctt       660
     ctttaaccct tggcggtgtg aagaagaatg cttcaatgct tggggtcgcc ctttgtttcc       720
     tcgggtgcgg gagggagggg ctgcacgtat ggtggggctg cctcacatct ctgaggggag       780
     ggaggaggag gtggtgggcc cgctgccctt ggcgtccctt tcctgtaggg aaaggataaa       840
     taaccgttat ggctatatag tatttttttt tctcttattc ctccggggac acgtttccaa       900
     gtcatctcag ggccttctct attgtattat ttctttccat atctctagtg cgtgggggta       960
     ggtgtctggc cccttgatgg cccattgccc agtgtgatct tctctttgtc ctctctcact      1020
     ccaggcccaa tcatggcaga tgaggaaatt gctgccctgg tggtggacaa tggctctggt      1080
     atgtgcaagg caggctttgc tggggatgat gcccctaggg ctgtgttccc ttccattgtg      1140
     ggacgccccc ggcatcaagg tgtcatggtg ggtatggggc agaaggacag ctatgtggga      1200
     gacgaagccc agagcaagag gggaatcctc accctgaagt atcctattga gcatggcatt      1260
     gtcaccaact gggatgacat ggagaagatc tggcaccaca ccttctacaa tgagttgcgt      1320
     gttgctccag aggagcaccc tgtcctgctt actgaggccc cgctgaaccc taaagccaac      1380
     agggagaaga tgacccagat catgtttgag accttcaaca ctccagctat gtacgtggcc      1440
     atccaggctg tgctgtccct ttatgcctct ggtcgcacca ccggcatcgt catggactct      1500
     ggggatggtg tcacccacac agtgcccatt tacgagggct atgctctgcc ccatgccatc      1560
     ctgcgtctgg acttggctgg ccgtgacctg actgactacc tcatgaagat cctaacagag      1620
     cgaggttata gcttcaccac cacggctgag agggagattg tccgtgatat caaggaaaag      1680
     ctgtgctatg ttgctctaga ctttgagcag gagatggcaa cggctgcctc atcctcctcc      1740
     ctagagaaaa gctatgagct gccggatggg caggtgatca ccattgggaa tgagcgcttc      1800
     cgatgccccg aggccatctt ccaaccttcc ttcttgggca tggagtcctg cggcatccac      1860
     gagaccacct tcaactccat catgaagtgt gatgtggaca tcaggaagga cctgtatgcc      1920
     aacaccgtgc tgtctggggg taccaccatg taccctggca tcgctgacag gatgcagaag      1980
     gagatcacag cgctagcacc cagcaccatg aagatcaaga tcatcgcccc accggagcgc      2040
     aagtattctg tctggattgg tggctccatc ctagcctccc tctccacctt ccagcagatg      2100
     tggatcagca agcaggagta tgatgagtct ggcccctcca tagtccatcg caagtgcttc      2160
     tagaggggct gctggcagtc acctggggcg tacccatagt ggggcaggca tgggaggagg      2220
     tgttgcaggc ttgtccttgg gagctctccc ttccggcttg gaccagtatt gaaagactgt      2280
     tacttatttt acgtgcaatt tgttgaggta ctgagtagta acatacggtg tgcattttaa      2340
     tggccttgcg ccagtttgga ccagttcgtg actagctttt tagtggagag aaatagcagc      2400
     ctgttggcgt ggttctgggg cagaaagtag atgagcagtt gttcacattt cctatgttaa      2460
     cactaacagg atgacactaa agtaggttgt cacctttagg tttgtcacat ctgacttgtt      2520
     tgtaggaaag caaataaact taggcttaaa agtgtaagac tctttcttgc tttcttctgg      2580
     ggtgggtgtg cttcgaaggg ttgcgtggta taaaggctta                            2620
//

If you have problems or comments...

PBIL Back to PBIL home page