(data stored in SCRATCH zone)

GenBank: X04831

LOCUS       X04831                   867 bp    DNA     linear   BCT 23-OCT-2008
DEFINITION  E. coli mutator gene mutT (A:T to C:G transversion).
ACCESSION   X04831
VERSION     X04831.1
KEYWORDS    mutator gene; mutT gene.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 867)
  AUTHORS   Akiyama,M., Horiuchi,T. and Sekiguchi,M.
  TITLE     Molecular cloning and nucleotide sequence of the mutT mutator of
            Escherichia coli that causes A:T to C:G transversion
  JOURNAL   Mol. Gen. Genet. 206 (1), 9-16 (1987)
   PUBMED   3033442
COMMENT     Inverted repeats B to E are almost identical. They represent the
            'repetitive extragenic palindromic sequence'.
FEATURES             Location/Qualifiers
     source          1..867
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /strain="K12 derivative MA 283"
                     /db_xref="taxon:562"
     regulatory      50..55
                     /regulatory_class="promoter"
                     /note="pot. -35 region"
     regulatory      75..80
                     /regulatory_class="promoter"
                     /note="pot. -10 region"
     regulatory      108..113
                     /regulatory_class="promoter"
                     /note="pot. alternate -35 region"
     repeat_region   122..132
                     /note="inverted repeat A"
     regulatory      133..138
                     /regulatory_class="promoter"
                     /note="pot. alternate -10 region"
     repeat_region   137..147
                     /note="inverted repeat A'"
     regulatory      152..155
                     /regulatory_class="ribosome_binding_site"
                     /note="pot. ribosome binding site"
     regulatory      157..160
                     /regulatory_class="ribosome_binding_site"
                     /note="pot. alternate ribosome binding site"
     CDS_pept        164..553
                     /note="unnamed protein product; MutT protein (AA 1-129)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="CAA28523.1"
                     /db_xref="GOA:P08337"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR003561"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="InterPro:IPR020476"
                     /db_xref="PDB:1MUT"
                     /db_xref="PDB:1PPX"
                     /db_xref="PDB:1PUN"
                     /db_xref="PDB:1PUQ"
                     /db_xref="PDB:1PUS"
                     /db_xref="PDB:1TUM"
                     /db_xref="PDB:3A6S"
                     /db_xref="PDB:3A6T"
                     /db_xref="PDB:3A6U"
                     /db_xref="PDB:3A6V"
                     /db_xref="UniProtKB/Swiss-Prot:P08337"
                     /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGE
                     TPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPG
                     EWMSLVGLNADDFPPANEPVIAKLKRL"
     repeat_region   549..631
                     /note="direct repeat 1"
     repeat_region   554..566
                     /note="inverted repeat B (imperfect)"
     repeat_region   571..583
                     /note="inverted repeat B'"
     repeat_region   597..610
                     /note="inverted repeat C (imperfect)"
     repeat_region   615..628
                     /note="inverted repeat C' (imperfect)"
     repeat_region   665..748
                     /note="direct repeat 1"
     repeat_region   670..682
                     /note="inverted repeat D (imperfect)"
     repeat_region   687..699
                     /note="inverted repeat D' (imperfect)"
     repeat_region   713..726
                     /note="inverted repeat E"
     repeat_region   732..745
                     /note="inverted repeat E' (imperfect)"
ORIGIN
        1 ctgcactggc ggcgcaaacc ggagagcgca aagtaggacg taacgatcct tgcccgtgcg
       61 gttctggtaa aaaatacaag cagtgccatg gccgcctgca ataaaagcta actgttgaag
      121 taaaaggcgc aggattctgc gcctttttta taggtttaag acaatgaaaa agctgcaaat
      181 tgcggtaggt attattcgca acgagaacaa tgaaatcttt ataacgcgtc gcgcagcaga
      241 tgcgcacatg gcgaataaac tggagtttcc cggcggtaaa attgaaatgg gtgaaacgcc
      301 ggaacaggcg gtggtgcgtg aacttcagga agaagtcggg attacccccc aacatttttc
      361 gctatttgaa aaactggaat atgaattccc ggacaggcat ataacactgt ggttttggct
      421 ggtcgaacgc tgggaagggg agccgtgggg taaagaaggg caacccggtg agtggatgtc
      481 gctggtcggt cttaatgccg atgattttcc gccagccaat gaaccggtaa ttgcgaagct
      541 taaacgtctg taggtcagat aaggcgtttt cgccgcatcc gacattcgca cacgatgcct
      601 gatgcgacgc tggcgcgtct tatcaggcct aaagggattt ctaactcatt gataaatttg
      661 tttttgtagg tcggataagg cgttcacgcc gcatccgaca tttgcacaag atgcctgatg
      721 cgacgctgtc cgcgtcttat caggcctacg tgcggcatca gacaaatgtc actgctttgg
      781 ttcttcgctc cagtcatcgc tttcggaaag atcgccactg ctggggattc gtttttcttc
      841 agcagcccat tctccgaggt cgatcag
//

If you have problems or comments...

PBIL Back to PBIL home page