(data stored in ACNUC9543 zone)

EMBL: X05021

ID   X05021; SV 1; linear; mRNA; STD; MUS; 507 BP.
XX
AC   X05021;
XX
DT   19-SEP-1987 (Rel. 13, Created)
DT   12-SEP-1993 (Rel. 36, Last updated, Version 2)
XX
DE   Murine mRNA with homology to yeast L29 ribosomal protein gene
XX
KW   ribosomal protein; unidentified reading frame.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-507
RX   DOI; 10.1093/nar/15.3.1019.
RX   PUBMED; 2434927.
RA   Belhumeur P., Paterno G.D., Boileau G., Claverie J.M., Skup D.;
RT   "Isolation and characterisation of a murine cDNA clone highly homologous to
RT   the yeast L29 ribosomal protein gene";
RL   Nucleic Acids Res. 15(3):1019-1029(1987).
XX
DR   MD5; 896410b0e7253bb487d98d7a06d8ba0a.
DR   Ensembl-Gn; ENSMUSG00000046364; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032842; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032826; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032757; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032540; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033336; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032513; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032618; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033357; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031575; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031981; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000143107; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085815; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085856; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086357; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085933; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085358; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085552; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085403; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085598; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085445; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086644; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084463; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..507
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="cCL3"
FT                   /cell_line="F9"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        23..469
FT                   /note="URF (homologous to yeast L29 ribosomal protein)"
FT                   /db_xref="GOA:P14115"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="MGI:MGI:1347076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14115"
FT                   /protein_id="CAA28678.1"
FT                   /translation="MPSRLRKTRKLRGHVSHGHGRIGKHRKHPSGRGNAGGMHHHRINF
FT                   DKYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKPWTLVSEQTRVNAAKNKTGVAPIIDVV
FT                   RSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA"
FT   polyA_site      507..507
FT                   /note="polyA site"
XX
SQ   Sequence 507 BP; 142 A; 129 C; 132 G; 104 T; 0 other;
     ttttcccatt tctgccaccg ctatgccatc cagactgagg aagacccgga aactccgggg        60
     ccacgtgagc cacggccacg gccgcatcgg taagcaccgc aagcacccaa gcggccgcgg       120
     gaatgctgga ggcatgcacc accacaggat caactttgac aaatatcacc caggttactt       180
     tgggaaagtt ggtatgcggc attaccactt gaagaggaac cagagcttct gcccaacagt       240
     caacttggat aaaccgtgga cattggtcag cgagcaaaca cgggtcaatg cggcaaaaaa       300
     caaaactgga gttgctccca tcattgatgt tgttcgatca ggctactaca aagttctggg       360
     caagggaaag ctccctaagc aacctgtcat cgtgaaggcc aaattcttca gcagaagagc       420
     tgaggagaag attaagggtg ttggaggtgc ctgtgttctg gtggcttaaa agccacaccg       480
     gaggttaatt aaatgctaac attttcc                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page