(data stored in ACNUC8465 zone)

EMBL: X06820

ID   X06820; SV 1; linear; mRNA; STD; HUM; 591 BP.
XX
AC   X06820;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   24-OCT-1996 (Rel. 49, Last updated, Version 6)
XX
DE   H.sapiens rhoB gene mRNA
XX
KW   GTP-binding protein; ras-related protein; rhoB gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-591
RA   Chardin P.;
RT   ;
RL   Submitted (12-FEB-1988) to the INSDC.
RL   Chardin P., INSERM U-248, Faculte de Medecine, Lariboisiere Saint-Louis, 10
RL   av. de Verdun 75010 Paris, France.
XX
RN   [2]
RP   1-591
RX   DOI; 10.1093/nar/16.6.2717.
RX   PUBMED; 3283705.
RA   Chardin P., Madaule P., Tavitian A.;
RT   "Coding sequence of human rho cDNAs clone 6 and clone 9";
RL   Nucleic Acids Res. 16(6):2717-2717(1988).
XX
DR   MD5; 836db97a6b4e72b59d4a60844d7fa24f.
DR   Ensembl-Gn; ENSG00000143878; homo_sapiens.
DR   Ensembl-Tr; ENST00000272233; homo_sapiens.
DR   EuropePMC; PMC1838499; 17372200.
DR   EuropePMC; PMC2735393; 14576147.
DR   EuropePMC; PMC29714; 11222756.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..591
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="6"
FT                   /tissue_type="tumour"
FT                   /tissue_type="pheochromocytoma"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..591
FT                   /gene="rhoB"
FT                   /db_xref="GOA:P62745"
FT                   /db_xref="H-InvDB:HIT000321220.13"
FT                   /db_xref="HGNC:HGNC:668"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2FV8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62745"
FT                   /protein_id="CAA29968.1"
FT                   /translation="MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVK
FT                   HFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKT
FT                   KEGVREVFETATRAALQKRYGSQNGCINCCKVL"
XX
SQ   Sequence 591 BP; 120 A; 182 C; 194 G; 95 T; 0 other;
     atggcggcca tccgcaagaa gctggtggtg gtgggcgacg gcgcgtgtgg caagacgtgc        60
     ctgctgatcg tgttcagtaa ggacgagttc cccgaggtgt acgtgcccac cgtcttcgag       120
     aactatgtgg ccgacattga ggtggacggc aagcaggtgg agctggcgct gtgggacacg       180
     gcgggccagg aggactacga ccgcctgcgg ccgctctcct acccggacac cgacgtcatt       240
     ctcatgtgct tctcggtgga cagcccggac tcgctggaga acatccccga gaagtgggtc       300
     cccgaggtga agcacttctg tcccaatgtg cccatcatcc tggtggccaa caaaaaagac       360
     ctgcgcagcg acgagcatgt ccgcacagag ctggcccgca tgaagcagga acccgtgcgc       420
     acggatgacg gccgcgccat ggccgtgcgc atccaagcct acgactacct cgagtgctct       480
     gccaagacca aggaaggcgt gcgcgaggtc ttcgagacgg ccacgcgcgc cgcgctgcag       540
     aagcgctacg gctcccagaa cggctgcatc aactgctgca aggtgctatg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page