(data stored in SCRATCH zone)

EMBL: X07166

ID   X07166; SV 1; linear; mRNA; STD; HUM; 3181 BP.
XX
AC   X07166;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   12-SEP-1993 (Rel. 36, Last updated, Version 2)
XX
DE   Human mRNA for enkephalinase (EC 3.4.24.11)
XX
KW   enkephalinase; metalloprotein; neutral endopeptidase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3181
RX   DOI; 10.1016/0014-5793(88)80828-7.
RX   PUBMED; 3162217.
RA   Malfroy B., Kuang W.J., Seeburg P.H., Mason A.J., Schofield P.R.;
RT   "Molecular cloning and amino acid sequence of human enkephalinase (neutral
RT   endopeptidase)";
RL   FEBS Lett. 229(1):206-210(1988).
XX
DR   MD5; a653e31655c86bab9197b06c56c4e3e9.
DR   Ensembl-Gn; ENSG00000196549; homo_sapiens.
DR   Ensembl-Tr; ENST00000360490; homo_sapiens.
DR   Ensembl-Tr; ENST00000460393; homo_sapiens.
DR   Ensembl-Tr; ENST00000462745; homo_sapiens.
DR   Ensembl-Tr; ENST00000492661; homo_sapiens.
DR   Ensembl-Tr; ENST00000493237; homo_sapiens.
DR   Ensembl-Tr; ENST00000615825; homo_sapiens.
DR   EuropePMC; PMC96872; 10496897.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3181
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt10"
FT                   /clone="lambda H7"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        18..2249
FT                   /note="enkephalinase (AA 1-743)"
FT                   /db_xref="GOA:P08473"
FT                   /db_xref="H-InvDB:HIT000321242.13"
FT                   /db_xref="HGNC:HGNC:7154"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029727"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="PDB:1DL9"
FT                   /db_xref="PDB:1DMT"
FT                   /db_xref="PDB:1QVD"
FT                   /db_xref="PDB:1R1H"
FT                   /db_xref="PDB:1R1I"
FT                   /db_xref="PDB:1R1J"
FT                   /db_xref="PDB:1Y8J"
FT                   /db_xref="PDB:2QPJ"
FT                   /db_xref="PDB:2YB9"
FT                   /db_xref="PDB:4CTH"
FT                   /db_xref="PDB:5JMY"
FT                   /db_xref="PDB:6GID"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08473"
FT                   /protein_id="CAA30157.1"
FT                   /translation="MDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATY
FT                   DDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILR
FT                   DELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVA
FT                   TENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSR
FT                   DYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATA
FT                   KPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVY
FT                   APEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETA
FT                   TWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAET
FT                   KKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLK
FT                   KLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIG
FT                   HEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGI
FT                   NTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPE
FT                   YAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW"
FT   misc_feature    3073..3078
FT                   /note="poly A signal"
XX
SQ   Sequence 3181 BP; 1055 A; 582 C; 657 G; 887 T; 0 other;
     gcaagtcaga aagtcagatg gatataactg atatcaacac tccaaagcca aagaagaaac        60
     agcgatggac tccactggag atcagcctct cggtccttgt cctgctcctc accatcatag       120
     ctgtgacaat gatcgcactc tatgcaacct acgatgatgg tatttgcaag tcatcagact       180
     gcataaaatc agctgctcga ctgatccaaa acatggatgc caccactgag ccttgtacag       240
     actttttcaa atatgcttgc ggaggctggt tgaaacgtaa tgtcattccc gagaccagct       300
     cccgttacgg caactttgac attttaagag atgaactaga agtcgttttg aaagatgtcc       360
     ttcaagaacc caaaactgaa gatatagtag cagtgcagaa agcaaaagca ttgtacaggt       420
     cttgtataaa tgaatctgct attgatagca gaggtggaga acctctactc aaactgttac       480
     cagacatata tgggtggcca gtagcaacag aaaactggga gcaaaaatat ggtgcttctt       540
     ggacagctga aaaagctatt gcacaactga attctaaata tgggaaaaaa gtccttatta       600
     atttgtttgt tggcactgat gataagaatt ctgtgaatca tgtaattcat attgaccaac       660
     ctcgacttgg cctcccttct agagattact atgaatgcac tggaatctat aaagaggctt       720
     gtacagcata tgtggatttt atgatttctg tggccagatt gattcgtcag gaagaaagat       780
     tgcccatcga tgaaaaccag cttgctttgg aaatgaataa agttatggaa ttggaaaaag       840
     aaattgccaa tgctacggct aaacctgaag atcgaaatga tccaatgctt ctgtataaca       900
     agatgacatt ggcccagatc caaaataact tttcactaga gatcaatggg aagccattca       960
     gctggttgaa tttcacaaat gaaatcatgt caactgtgaa tattagtatt acaaatgagg      1020
     aagatgtggt tgtttatgct ccagaatatt taaccaaact taagcccatt cttaccaaat      1080
     attctgccag agatcttcaa aatttaatgt cctggagatt cataatggat cttgtaagca      1140
     gcctcagccg aacctacaag gagtccagaa atgctttccg caaggccctt tatggtacaa      1200
     cctcagaaac agcaacttgg agacgttgtg caaactatgt caatgggaat atggaaaatg      1260
     ctgtggggag gctttatgtg gaagcagcat ttgctggaga gagtaaacat gtggtcgagg      1320
     atttgattgc acagatccga gaagttttta ttcagacttt agatgacctc acttggatgg      1380
     atgccgagac aaaaaagaga gctgaagaaa aggccttagc aattaaagaa aggatcggct      1440
     atcctgatga cattgtttca aatgataaca aactgaataa tgagtacctc gagttgaact      1500
     acaaagaaga tgaatacttc gagaacataa ttcaaaattt gaaattcagc caaagtaaac      1560
     aactgaagaa gctccgagaa aaggtggaca aagatgagtg gataagtgga gcagctgtag      1620
     tcaatgcatt ttactcttca ggaagaaatc agatagtctt cccagccggc attctgcagc      1680
     cccccttctt tagtgcccag cagtccaact cattgaacta tgggggcatc ggcatggtca      1740
     taggacacga aatcacccat ggcttcgatg acaatggcag aaactttaac aaagatggag      1800
     acctcgttga ctggtggact caacagtctg caagtaactt taaggagcaa tcccagtgca      1860
     tggtgtatca gtatggaaac ttttcctggg acctggcagg tggacagcac cttaatggaa      1920
     ttaatacact gggagaaaac attgctgata atggaggtct tggtcaagca tacagagcct      1980
     atcagaatta tattaaaaag aatggcgaag aaaaattact tcctggactt gacctaaatc      2040
     acaaacaact atttttcttg aactttgcac aggtgtggtg tggaacctat aggccagagt      2100
     atgcggttaa ctccattaaa acagatgtgc acagtccagg caatttcagg attattggga      2160
     ctttgcagaa ctctgcagag ttttcagaag cctttcactg ccgcaagaat tcatacatga      2220
     atccagaaaa gaagtgccgg gtttggtgat cttcaaaaga agcattgcag cccttggcta      2280
     gacttgccaa caccacagaa atggggaatt ctctaatcga aagaaaatgg gccctagggg      2340
     tcactgtact gacttgaggg tgattaacag agagggcacc atcacaatac agataacatt      2400
     aggttgtcct agaaagggtg tggagggagg aagggggtct aaggtctatc aagtcaatca      2460
     tttctcactg tgtacataat gcttaatttc taaagataat attactgttt atttctgttt      2520
     ctcatatggt ctaccagttt gctgatgtcc ctagaaaaca atgcaaaacc tttgaggtag      2580
     accaggattt ctaatcaaaa gggaaaagaa gatgttgaag aatacagtta ggcaccagaa      2640
     gaacagtagg tgacactata gtttaaaaca cattgcctaa ctactagttt ttacttttat      2700
     ttgcaacatt tacagtcctt caaaatcctt ccaaagaatt cttatacaca ttggggcctt      2760
     ggagcttaca tagttttaaa ctcatttttg ccatacatca gttattcatt ctgtgatcat      2820
     ttattttaag cactcttaaa gcaaaaaatg aatgtctaaa attgtttttt gttgtacctg      2880
     ctttgactga tgctgagatt cttcaggctt cctgcaattt tctaagcaat ttcttgctct      2940
     atctctcaaa acttggtatt tttcagagat ttatataaat gtaaaaataa taatttttat      3000
     atttaattat taactacatt tatgagtaac tattattata ggtaatcaat gaatattgaa      3060
     gtttcagctt aaaataaaca gttgtgaacc aagatctata aagcgatata cagatgaaaa      3120
     tttgagacta tttaaactta taaatcatat tgatgaaaag atttaagcac aaactttagg      3180
     g                                                                      3181
//

If you have problems or comments...

PBIL Back to PBIL home page