(data stored in ACNUC31108 zone)

EMBL: X07982

ID   X07982; SV 1; linear; mRNA; STD; HUM; 826 BP.
XX
AC   X07982;
XX
DT   07-OCT-1988 (Rel. 18, Created)
DT   27-MAR-1995 (Rel. 43, Last updated, Version 3)
XX
DE   Human mRNA for melanoma-associated antigen ME491
XX
KW   antigen; glycoprotein; ME491 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-826
RX   PUBMED; 3365686.
RA   Hotta H., Ross A.H., Huebner K., Isobe M., Wendeborn S., Chao M.V.,
RA   Ricciardi R.P., Tsujimoto Y., Croce C.M., Koprowski H.;
RT   "Molecular cloning and characterization of an antigen associated with early
RT   stages of melanoma tumor progression";
RL   Cancer Res. 48(11):2955-2962(1988).
XX
DR   MD5; 84ceac41b61ee180e3c2c04c33d143be.
DR   Ensembl-Gn; ENSG00000135404; homo_sapiens.
DR   Ensembl-Tr; ENST00000257857; homo_sapiens.
DR   Ensembl-Tr; ENST00000420846; homo_sapiens.
DR   Ensembl-Tr; ENST00000546939; homo_sapiens.
DR   Ensembl-Tr; ENST00000549117; homo_sapiens.
DR   Ensembl-Tr; ENST00000550776; homo_sapiens.
DR   Ensembl-Tr; ENST00000552692; homo_sapiens.
DR   Ensembl-Tr; ENST00000552754; homo_sapiens.
XX
CC   Data kindly reviewed (24-Oct-1988) by Ross A.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..826
FT                   /organism="Homo sapiens"
FT                   /chromosome="12q12-12q14"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt11"
FT                   /cell_line="WM 1158"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        28..744
FT                   /note="ME491 antigen precursor (AA -1 to 237)"
FT                   /db_xref="GOA:P08962"
FT                   /db_xref="H-InvDB:HIT000321292.12"
FT                   /db_xref="HGNC:HGNC:1692"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08962"
FT                   /protein_id="CAA30792.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQ
FT                   GATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKN
FT                   RVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIV
FT                   FACCLVKSIRSGYEVM"
FT   mat_peptide     31..741
FT                   /note="mature ME491 antigen (AA 1-237)"
FT   misc_feature    31..51
FT                   /note="NH2 terminal sequence (AA 1-7)"
FT   misc_feature    55..90
FT                   /note="NH2 terminal sequence (AA 9-20)"
FT   misc_feature    415..423
FT                   /note="N-linked glycosylation site"
FT   misc_feature    475..483
FT                   /note="N-linked glycosylation site"
FT   misc_feature    541..549
FT                   /note="N-linked glycosylation site"
FT   misc_feature    806..811
FT                   /note="polyA signal"
XX
SQ   Sequence 826 BP; 168 A; 178 C; 250 G; 230 T; 0 other;
     gccttgggaa gcccaggccc ggcagccatg gcggtggaag gaggaatgaa atgtgtgaag        60
     ttcttgctct acgtcctcct gctggccttt tgcgcctgtg cagtgggact gattgccgtg       120
     ggtgtcgggg cacagcttgt cctgagtcag accataatcc agggggctac ccctggctct       180
     ctgttgccag tggtcatcat cgcagtgggt gtcttcctct tcctggtggc ttttgtgggc       240
     tgctgcgggg cctgcaagga gaactattgt cttatgatca cgtttgccat ctttctgtct       300
     cttatcatgt tggtggaggt ggccgcagcc attgctggct atgtgtttag agataaggtg       360
     atgtcagagt ttaataacaa cttccggcag cagatggaga attacccgaa aaacaaccac       420
     actgcttcga tcctggacag gatgcaggca gattttaagt gctgtggggc tgctaactac       480
     acagattggg agaaaatccc ttccatgtcg aagaaccgag tccccgactc ctgctgcatt       540
     aatgttactg tgggctgtgg gattaatttc aacgagaagg cgatccataa ggagggctgt       600
     gtggagaaga ttgggggctg gctgaggaaa aatgtgctgg tggtagctgc agcagccctt       660
     ggaattgctt ttgtcgaggt tttgggaatt gtctttgcct gctgcctcgt gaagagtatc       720
     agaagtggct acgaggtgat gtaggggtct ggtctcctca gcctcctcat ctgggggagt       780
     ggaatagtat cctccaggtt tttcaattaa acggattatt ttttca                      826
//

If you have problems or comments...

PBIL Back to PBIL home page