(data stored in ACNUC16935 zone)

EMBL: X13493

ID   X13493; SV 1; linear; mRNA; STD; VRT; 257 BP.
XX
AC   X13493;
XX
DT   01-DEC-1988 (Rel. 18, Created)
DT   27-JUN-2018 (Rel. 137, Last updated, Version 6)
XX
DE   Chicken mRNA for ubiquitin-fusion protein.
XX
KW   metal binding protein; nuclear localization signal; ubiquitin;
KW   ubiquitin-fusion protein.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-257
RA   Mezquita C;
RT   ;
RL   Submitted (10-NOV-1988) to the INSDC.
RL   to the INSDC. Mezquita C., Mol Genetics Research Group, Faculty of
RL   Medicine, University of Barcelona, Diagonal sn 08028, Barcelona, Spain.
XX
RN   [2]
RA   Mezquita J, Pau M, Mezquita C;
RT   "cDNA encoding a chicken ubiquitin-fusion protein identical to the
RT   corresponding human protein";
RL   Nucleic Acids Res. 16(24):11838-11838(1988).
XX
DR   MD5; b6459d3594222e53b1bb861d06d94641.
DR   EuropePMC; PMC339136; 2850543.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..257
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /clone="ubif1"
FT                   /cell_type="spermatid"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        <1..210
FT                   /codon_start=1
FT                   /product="ubiquitin-fusion protein (69 AA)"
FT                   /db_xref="GOA:P62985"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62985"
FT                   /protein_id="CAA31848.1"
FT                   /translation="NIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   misc_feature    <1..51
FT                   /note="ubiquitin (17 AA; AA 60-76)"
FT   misc_feature    52..207
FT                   /note="carboxy terminal extension (52 AA)"
FT   misc_feature    94..168
FT                   /note="put. metal binding and nucleic acid binding domain"
FT   misc_feature    187..207
FT                   /note="put. nuclear localization signal"
FT   regulatory      240..245
FT                   /note="polyA signal"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      257..257
FT                   /note="polyA site"
XX
SQ   Sequence 257 BP; 61 A; 86 C; 65 G; 45 T; 0 other;
     aacatccaga aagagtccac cctgcacctg gtgctgcgtc tgcgcggggg tatcattgag        60
     ccctccctgc ggcagttggc ccagaagtac aactgcgata agatgatctg ccgcaagtgc       120
     tacgcccgcc tccatccccg tgccgtcaac tgccgcaaga agaagtgcgg ccacaccaac       180
     aacctgcgcc ccaagaagaa ggtcaaatag agcggctctg caccccgctg tcgtctgcta       240
     ataaagcatc tgcgttc                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page