(data stored in ACNUC31108 zone)

EMBL: X14046

ID   X14046; SV 1; linear; mRNA; STD; HUM; 1125 BP.
XX
AC   X14046;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   12-SEP-1993 (Rel. 36, Last updated, Version 4)
XX
DE   Human mRNA for leukocyte antigen CD37
XX
KW   antigen; CD37 antigen; cell surface glycoprotein; transmembrane protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Classon B.J.;
RT   ;
RL   Submitted (13-JAN-1989) to the INSDC.
RL   Classon B.J., MRC Cellular Immunology Unit, Sir William Dunn, School of
RL   Pathology, University of Oxford, Oxford, OX1 3RE, England.
XX
RN   [2]
RC   revised by [3]
RX   DOI; 10.1084/jem.169.4.1497.
RX   PUBMED; 2466944.
RA   Classon B.J., Williams A.F., Willis A.C., Seed B., Stamenkovic I.;
RT   "The primary structure of the human leukocyte antigen CD37, a species
RT   homologue of the rat MRC OX-44 antigen";
RL   J. Exp. Med. 169(4):1497-1502(1989).
XX
RN   [3]
RP   1-1125
RA   Classon B.J.;
RT   ;
RL   Submitted (25-MAY-1990) to the INSDC.
XX
DR   MD5; a0da686561492c7eef8ef2a2cd34eafd.
DR   Ensembl-Gn; ENSG00000104894; homo_sapiens.
DR   Ensembl-Tr; ENST00000323906; homo_sapiens.
DR   Ensembl-Tr; ENST00000426897; homo_sapiens.
DR   Ensembl-Tr; ENST00000598095; homo_sapiens.
DR   EuropePMC; PMC16559; 10840051.
XX
CC   The human leukocyte antigen CD37 is a species homolog of
CC   the rat MRC OX-44 antigen.
CC
CC   Data kindly reviewed (23-Jun-1989) by Classon B.J.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1125
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="CD37.1"
FT                   /cell_line="CLL leukemia"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        64..909
FT                   /note="CD37 (AA 1-244)"
FT                   /db_xref="GOA:P11049"
FT                   /db_xref="H-InvDB:HIT000321409.12"
FT                   /db_xref="HGNC:HGNC:1666"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11049"
FT                   /protein_id="CAA32204.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVS
FT                   FVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQ
FT                   VLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAE
FT                   SHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
FT                   "
FT   old_sequence    747..749
FT                   /note="ggg was gg in [1]"
FT                   /citation=[1]
XX
SQ   Sequence 1125 BP; 191 A; 388 C; 291 G; 255 T; 0 other;
     gtctccccca ctgtcagcac ctcttctgtg tggtgagtgg accgcttacc ccactaggtg        60
     aagatgtcag cccaggagag ctgcctcagc ctcatcaagt acttcctctt cgttttcaac       120
     ctcttcttct tcgtcctcgg cagcctgatc ttctgcttcg gcatctggat cctcatcgac       180
     aagaccagct tcgtgtcctt tgtgggcttg gccttcgtgc ctctgcagat ctggtccaaa       240
     gtcctggcca tctcaggaat cttcaccatg ggcatcgccc tcctgggttg tgtgggggcc       300
     ctcaaggagc tccgctgcct cctgggcctg tattttggga tgctgctgct cctgtttgcc       360
     acacagatca ccctgggaat cctcatctcc actcagcggg cccagctgga gcgaagcttg       420
     cgggacgtcg tagagaaaac catccaaaag tacggcacca accccgagga gaccgcggcc       480
     gaggagagct gggactatgt gcagttccag ctgcgctgct gcggctggca ctacccgcag       540
     gactggttcc aagtcctcat cctgagaggt aacgggtcgg aggcgcaccg cgtgccctgc       600
     tcctgctaca acttgtcggc gaccaacgac tccacaatcc tagataaggt gatcttgccc       660
     cagctcagca ggcttggaca cctggcgcgg tccagacaca gtgcagacat ctgcgctgtc       720
     cctgcagaga gccacatcta ccgcgagggc tgcgcgcagg gcctccagaa gtggctgcac       780
     aacaacctta tttccatagt gggcatttgc ctgggcgtcg gcctactcga gctcgggttc       840
     atgacgctct cgatattcct gtgcagaaac ctggaccacg tctacaaccg gctcgctcga       900
     taccgttagg ccccgccctc cccaaagtcc cgccccgccc ccgtcacgtg cgctgggcac       960
     ttccctgctg cctgtaaata tttgtttaat ccccagttcg cctggagccc tccgccttca      1020
     cattcccctg gggacccacg tggctgcgtg cccctgctgc tgtcacctct cccacgggac      1080
     ctggggcttt cgtccacagc ttcctgtccc catctgtcgg cctac                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page