(data stored in SCRATCH zone)

GenBank: TTU42226

LOCUS       TTU42226                8495 bp    DNA     linear   BCT 24-JUL-2016
DEFINITION  Integron In2 found in Tn21 (Shigella flexneri) sulphonamide
            resistant dihydropteroate synthase (sul1), IstB (istB), IstA
            (istA), TniBdelta1 (tniBdelta1) and TniA (tniA) genes, complete
            cds.
ACCESSION   U42226 U12417 X15371
VERSION     U42226.2
KEYWORDS    .
SOURCE      Shigella flexneri
  ORGANISM  Shigella flexneri
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Shigella.
REFERENCE   1  (bases 1 to 1717)
  AUTHORS   Stokes,H.W. and Hall,R.M.
  TITLE     A novel family of potentially mobile DNA elements encoding
            site-specific gene-integration functions: integrons
  JOURNAL   Mol. Microbiol. 3 (12), 1669-1683 (1989)
   PUBMED   2560119
REFERENCE   2  (bases 1 to 2441)
  AUTHORS   Hall,R.M., Brown,H.J., Brookes,D.E. and Stokes,H.W.
  TITLE     Integrons found in different locations have identical 5' ends but
            variable 3' ends
  JOURNAL   J. Bacteriol. 176 (20), 6286-6294 (1994)
   PUBMED   7929000
REFERENCE   3  (bases 2411 to 8495)
  AUTHORS   Brown,H.J., Stokes,H.W. and Hall,R.M.
  TITLE     The integrons In0, In2, and In5 are defective transposon
            derivatives
  JOURNAL   J. Bacteriol. 178 (15), 4429-4437 (1996)
   PUBMED   8755869
REFERENCE   4  (bases 1 to 8495)
  AUTHORS   Partridge,S.R. and Hall,R.M.
  TITLE     In34, a complex In5-like class 1 integron containing orf513 and
            dfrA10
  JOURNAL   Unpublished
  REMARK    correction of sequence errors
REFERENCE   5  (bases 1 to 8495)
  AUTHORS   Hall,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-1995) Ruth M. Hall, CSIRO Division of
            Biomolecular Engineering, PO Box 184, North Ryde, NSW, 2113,
            Australia
REFERENCE   6  (bases 1 to 8495)
  AUTHORS   Partridge,S.R. and Hall,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2002) CSIRO Molecular Science, PO Box 184, North
            Ryde, NSW 1670, Australia
  REMARK    Sequence update by submitter
COMMENT     On Jul 23, 2002 this sequence version replaced U42226.1.
FEATURES             Location/Qualifiers
     source          1..8495
                     /organism="Shigella flexneri"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:623"
                     /plasmid="R100"
                     /note="plasmid R100 also known as NR1"
     mobile_element  1..8495
                     /note="contained in Tn21; In2 is an integron and a
                     defective transposon derivative"
                     /mobile_element_type="transposon:Integron In2"
     misc_feature    1..8438
                     /note="right end of In2"
     misc_feature    1..1674
                     /note="3'-conserved segment of integron"
     gene            86..938
                     /gene="sul1"
     regulatory      86..90
                     /regulatory_class="ribosome_binding_site"
                     /gene="sul1"
                     /citation=[1]
     CDS_pept        99..938
                     /gene="sul1"
                     /citation=[1]
                     /codon_start=1
                     /transl_table=11
                     /product="sulphonamide resistant, dihydropteroate
                     synthase"
                     /protein_id="AAC53726.1"
                     /translation="MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDV
                     GPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLND
                     IQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSAL
                     RRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGAT
                     VGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGL
                     DHA"
     misc_feature    933..966
                     /note="left half of potential 59 base element"
     regulatory      1056..1058
                     /regulatory_class="ribosome_binding_site"
                     /note="orf5"
     CDS_pept        1066..1566
                     /note="orf5"
                     /citation=[1]
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC53727.1"
                     /translation="MDSEEPPNVRVACSGDIDEVVRLMHDAAAWMSAKGTPAWDVARI
                     DRTFAETFVLRSELLVASCSDGIVGCCTLSAEDPEFWPDALKGEAAYLHKLAVRRTHA
                     GRGVSSALIEACRHAARTQGCAKLRLDCHPNLRGLYERLGFTHVDTFNPGWDPTFIAE
                     RLELEI"
     old_sequence    1506
                     /citation=[1]
                     /replace="ctc"
     old_sequence    1541..1542
                     /citation=[1]
                     /replace="ac"
     misc_feature    1674..1675
                     /note="sequence diverges from those of integrons In1, In3,
                     In4 and In5"
                     /citation=[1]
                     /citation=[2]
     mobile_element  join(1675..4118,5733..5760)
                     /note="member of the IS21 family; IS1326 is found in
                     integrons In0 and In5; for further details see GenBank
                     Accession Number U38187"
                     /mobile_element_type="insertion sequence:IS1326"
     repeat_region   1675..1700
                     /note="terminal IR of IS1326"
                     /rpt_type=inverted
     old_sequence    1683..1684
                     /citation=[1]
                     /replace="g"
     old_sequence    1695..1696
                     /citation=[1]
                     /replace="g"
     old_sequence    1707..1708
                     /citation=[1]
                     /replace="g"
     gene            complement(1742..2536)
                     /gene="istB"
     CDS_pept        complement(1742..2527)
                     /gene="istB"
                     /note="contains NTP binding domain motifs"
                     /citation=[3]
                     /codon_start=1
                     /transl_table=11
                     /product="IstB"
                     /protein_id="AAC53728.1"
                     /translation="MMQHEGHVRILKSLKLFGMAHAIEELGNQNSPAFNQALPMLDSL
                     IKAEVAEREVRSVNYQLRVAKFPVYRDLVGFDFSQSLVNEATVKQLHRCDFMEQAQNV
                     VLIGGPGTGKTHLATAIGTQAVMHLNRRVRFFSTVDLVNALEQEKSSGRQGQIANRLL
                     YADLVILDELGYLPFSQTGGALLFHLLSKLYEKTSVILTTNLSFSEWSRVFGDEKMTT
                     ALLDRLTHHCHILETGNESYRFKHSSTQNKQEEKQTRKLKIET"
     gene            complement(2514..4037)
                     /gene="istA"
     CDS_pept        complement(2514..4037)
                     /gene="istA"
                     /note="possible alternative start at 4028; contains a
                     helix-turn-helix motif and a D, D (45) E motif; possible
                     transposase of IS1326"
                     /citation=[3]
                     /codon_start=1
                     /transl_table=11
                     /product="IstA"
                     /protein_id="AAC53729.1"
                     /translation="MINVAILSAIRRWHFRDGASIREIARRSGLSRNTVRKYLQSKVV
                     EPQYPARDSVGKLSPFEPKLRQWLSTEHKKTKKLRRNLRSMYRDLVALGFTGSYDRVC
                     AFARQWKDSEQFKAQTSGKGCFIPLRFACGEAFQFDWSEDFARIAGKQVKLQIAQFKL
                     AHSRAFVLRAYYQQKHEMLFDAHWHAFQIFGGIPKRGIYDNMKTAVDSVGRGKERRVN
                     QRFTAMVSHYLFDAQFCNPASGWEKGQIEKNVQDSRQRLWQGAPDFQSLADLNVWLEH
                     RCKALWSELRHPELDQTVQEAFADEQGELMALPNAFDAFVEQTKRVTSTCLVHHEGNR
                     YSVPASYANRAISLRIYADKLVMAAEGQHIAEHPRLFGSGHARRGHTQYDWHHYLSVL
                     QKKPGALRNGAPFAELPPAFKKLQSILLQRPGGDRDMVEILALVLHHDEGAVLSAVEL
                     ALECGKPSKEHVLNLLGRLTEEPPPKPIPIPKGLRLTLEPQANVNRYDSLRRAHDAA"
     regulatory      complement(2533..2536)
                     /regulatory_class="ribosome_binding_site"
                     /gene="istB"
     mobile_element  4119..5732
                     /note="member of the IS3 family; for further details see
                     GenBank Accession Number U40482"
                     /mobile_element_type="insertion sequence:IS1353"
     repeat_region   4119..4130
                     /note="terminal IR of IS1353"
                     /rpt_type=inverted
     regulatory      4137..4142
                     /regulatory_class="minus_35_signal"
     regulatory      4150..4153
                     /regulatory_class="ribosome_binding_site"
     CDS_pept        4160..5704
                     /note="orfAB; possible alternate starts at nt 4190 or at
                     nt 4220"
                     /citation=[3]
                     /codon_start=1
                     /transl_table=11
                     /product="OrfAB"
                     /protein_id="AAC53730.2"
                     /translation="MYSYEDRLRAVRLYLKLGRRMSATLRQLGYPTKNSLKAWLAEFE
                     RNQDLRRGYQRIKRQYTDEQKQRAVDHYIEQGYCLSHTIRSLGYPSREALRAWIRDLR
                     PEFARTVVGSSAPTVARSRLEKQQAVIALNLRVGSAKDVADTVGVSRPTLYNWQHRLL
                     GKVPLKPMTKKKGDTSLEQRHEALLRELAELESQNQRLRMENAILEKASELIKKDMGI
                     NPLELTSREKTKVVDALRVTFPLANLLCGLKLARSTYFYQRLRQTRPDKYTQVREVIR
                     TIFEDNYRCYGYRRIDSALRLGGMRVSEKVVRRLMAQERLVVRTPRRRRFSAYAGDPT
                     PAVPNLLNRDFHASAPNTKWLTDLTEIHIPAGKVYVSPIVDCFDGLVVAWNIGTSPDA
                     NLVNTMLDHAVRTLRPGEHPVIHSDRGSHYRWPAWIRRTENAQLTRSMSKKGCSPDNA
                     ACEGFFGRLKTELIYPRNWQHVTLKDLMTRIDAYIHWYNERRIKVSLGGRSPIEYRHA
                     VGLMSV"
     regulatory      4161..4166
                     /regulatory_class="minus_10_signal"
     regulatory      4192..4195
                     /regulatory_class="ribosome_binding_site"
                     /note="possible for orfAB"
     old_sequence    4465..4467
                     /citation=[4]
                     /replace="cc"
     old_sequence    4533
                     /citation=[4]
                     /replace="aa"
     old_sequence    4795..4801
                     /citation=[4]
                     /replace="aaaaaa"
     stem_loop       4807..4862
     repeat_region   5720..5732
                     /note="terminal IR of IS1353"
                     /rpt_type=inverted
     repeat_region   5735..5760
                     /note="terminal IR of IS1326"
                     /rpt_type=inverted
     gene            complement(5755..6628)
                     /gene="tniBdelta1"
     CDS_pept        complement(5755..6615)
                     /gene="tniBdelta1"
                     /codon_start=1
                     /transl_table=11
                     /product="TniBdelta1"
                     /protein_id="AAC53732.1"
                     /translation="MDEYPIIDLSHLLPAAQGLARLPADERIQRLRADRWIGYPRAVE
                     ALNRLEALYAWPNKQRMPNLLLVGPTNNGKSMIVEKFRRTHPASSDADQEHIPVLVVQ
                     MPSEPSVIRFYVALLAAMGAPLRPRPRLPEMEQLALALLRKVGVRMLVIDELHNVLAG
                     NSVNRREFLNLLRFLGNELRIPLVGVGTRDAYLAIRSDDQLENRFEPMMLPVWEANDD
                     CCSLLASFAASLPLRRPSPIATLDMARYLLTRSEGTIGELAHLLMAAAIVAVESGEEA
                     INHRTLSMAC"
     misc_feature    5761..8438
                     /note="same as part of the tni module of integron Tn402,
                     GenBank Accession Number X72585"
     misc_feature    5761..6199
                     /note="this sequence is not present in In5"
     gene            complement(6618..8333)
                     /gene="tniA"
     CDS_pept        complement(6618..8333)
                     /gene="tniA"
                     /note="possible transposase; possible alternate start at
                     8296"
                     /codon_start=1
                     /transl_table=11
                     /product="TniA"
                     /protein_id="AAC53733.1"
                     /translation="MLNTRVHQSEVSMATDTPRIPEQGVATLPDEAWERARRRAEIIS
                     PLAQSETVGHEAADMAAQALGLSRRQVYVLIRRARQGSGLVTDLVPGQSGGGKGKGRL
                     PEPVERVIHELLQKRFLTKQKRSLAAFHREVTQVCKAQKLRVPARNTVALRIASLDPR
                     KVIRRREGQDAARDLQGVGGEPPAVTAPLEQVQIDHTVIDLIVVDDRDRQPIGRPYLT
                     LAIDVFTRCVLGMVVTLEAPSAVSVGLCLVHVACDKRPWLEGLNVEMDWQMSGKPLLL
                     YLDNAAEFKSEALRRGCEQHGIRLDYRPLGQPHYGGIVERIIGTAMQMIHDELPGTTF
                     SNPDQRGDYDSENKAALTLRELERWLTLAVGTYHGSVHNGLLQPPAARWAEAVARVGV
                     PAVVTRATSFLVDFLPILRRTLTRTGFVIDHIHYYADALKPWIARRERWPSFLIRRDP
                     RDISRIWVLEPEGQHYLEIPYRTLSHPAVTLWEQRQALAKLRQQGREQVDESALFRMI
                     GQMREIVTSAQKATRKARRDADRRQHLKTSARPDKPVPPDTDIADPQADNLPPAKPFD
                     QIEEW"
     regulatory      complement(6624..6628)
                     /regulatory_class="ribosome_binding_site"
                     /gene="tniBdelta1"
     misc_feature    8251..8495
                     /note="overlaps the R100 sequence, Genbank Accession
                     Number X03405"
     regulatory      complement(8303..8306)
                     /regulatory_class="ribosome_binding_site"
                     /gene="tniA"
     regulatory      complement(8360..8365)
                     /regulatory_class="minus_10_signal"
     regulatory      complement(8385..8390)
                     /regulatory_class="minus_35_signal"
     repeat_region   8414..8438
                     /note="terminal IR of integron"
                     /rpt_type=inverted
ORIGIN
        1 aagcttgatg cgtggggctt tgtaggtatg gggctcataa ttgctgcctt tttgctcgcc
       61 cgatccccat cgtggaagtc gctgcggagg ccgacgccat ggtgacggtg ttcggcattc
      121 tgaatctcac cgaggactcc ttcttcgatg agagccggcg gctagacccc gccggcgctg
      181 tcaccgcggc gatcgaaatg ctgcgagtcg gatcagacgt cgtggatgtc ggaccggccg
      241 ccagccatcc ggacgcgagg cctgtatcgc cggccgatga gatcagacgt attgcgccgc
      301 tcttagacgc cctgtccgat cagatgcacc gtgtttcaat cgacagcttc caaccggaaa
      361 cccagcgcta tgcgctcaag cgcggcgtgg gctacctgaa cgatatccaa ggatttcctg
      421 accctgcgct ctatcccgat attgctgagg cggactgcag gctggtggtt atgcactcag
      481 cgcagcggga tggcatcgcc acccgcaccg gtcaccttcg acccgaagac gcgctcgacg
      541 agattgtgcg gttcttcgag gcgcgggttt ccgccttgcg acggagcggg gtcgctgccg
      601 accggctcat cctcgatccg gggatgggat ttttcttgag ccccgcaccg gaaacatcgc
      661 tgcacgtgct gtcgaacctt caaaagctga agtcggcgtt ggggcttccg ctattggtct
      721 cggtgtcgcg gaaatccttc ttgggcgcca ccgttggcct tcctgtaaag gatctgggtc
      781 cagcgagcct tgcggcggaa cttcacgcga tcggcaatgg cgctgactac gtccgcaccc
      841 acgcgcctgg agatctgcga agcgcaatca ccttctcgga aaccctcgcg aaatttcgca
      901 gtcgcgacgc cagagaccga gggttagatc atgcctagca ttcaccttcc ggccgcccgc
      961 tagcggaccc tggtcaggtt ccgcgaaggt gggcgcagac atgctgggct cgtcaggatc
     1021 aaactgcact atgaggcggc ggttcatacc gcgccagggg agcgaatgga cagcgaggag
     1081 cctccgaacg ttcgggtcgc ctgctcgggt gatatcgacg aggttgtgcg gctgatgcac
     1141 gacgctgcgg cgtggatgtc cgccaaggga acgcccgcct gggacgtcgc gcggatcgac
     1201 cggacattcg cggagacctt cgtcctgaga tccgagctcc tagtcgcgag ttgcagcgac
     1261 ggcatcgtcg gctgttgcac cttgtcggcc gaggatcccg agttctggcc cgacgccctc
     1321 aagggggagg ccgcatatct gcacaagctc gcggtgcgac ggacacatgc gggccggggt
     1381 gtcagctccg cgctgatcga ggcttgccgc catgccgcgc gaacgcaggg gtgcgccaag
     1441 ctgcggctcg actgccaccc gaacctgcgt ggcctatacg agcggctcgg attcacccac
     1501 gtcgacactt tcaatcccgg ctgggatcca accttcatcg cagaacgcct agaactcgaa
     1561 atctaacgtc cgttcgggca tcgaggtcca tgtcggggtg ggacgggccc gtggcttcaa
     1621 gatcacttgc agtccgaccg cgatgtcttg gttgcgcgag aggttgtcga tatctgttga
     1681 tttgcaccca aatttgaccc gggatttgca ttgaattttg acccacccct tgttgtcaga
     1741 attatgtctc gattttcagt ttgcgggtct gtttttcctc ctgcttattc tgagttgaac
     1801 tgtgtttgaa gcggtaactt tcattgccgg tttccaggat gtggcagtgg tgggttagtc
     1861 ggtccaacaa cgctgttgtc atcttttcat cgccaaacac tcggctccat tccgagaagc
     1921 tcaagttggt ggtcagtatc acgctggttt tttcgtacag ctttgagagc aggtgaaaca
     1981 gcagtgcccc accggtttgg ctaaaaggca aatatcccag ctcatccaga atcaccaaat
     2041 cggcatacaa cagacggttt gcgatttgtc cctgacgccc agatgatttc tcttgctcca
     2101 gtgcattgac caaatccacg gtggagaaga aacgcacccg tcggttcaag tgcatcactg
     2161 cttgtgtacc aatggctgtg gccaggtgag tcttgcctgt gcctggccca ccaatcagca
     2221 ccacgttctg ggcttgttcc atgaagtcgc accggtgcaa ttgtttgacc gtggcctcat
     2281 taaccaggct ttgactgaag tcaaagccca ccaagtcccg atacacgggg aacttggcca
     2341 cccgcaattg atagttcacc gaacgtactt cacgctctgc cacttcagct ttaatcaagc
     2401 tgtccagcat gggcaaggct tgattaaatg ctggtgaatt ctgattgccc aactcctcaa
     2461 tggcgtgtgc catgccaaag agtttcaagg atttgaggat tctcacatgg ccttcatgct
     2521 gcatcatggg ctctccttaa actgtcatag cggttcacgt tggcctgtgg ttccaatgtc
     2581 agccttaacc ccttgggaat tggaatcggt ttgggtggag gttcttcggt caaacgtccc
     2641 aacagattaa gcacatgctc cttcgatggc ttgccacact ccaatgccaa ttccacagca
     2701 ctgagtaccg caccttcatc gtggtgcaat acaagggcca gaatttccac catgtcacgg
     2761 tcaccgccgg ggcgttgcag caagatggat tgaagcttct tgaacgcggg tggcaattca
     2821 gcaaatggcg caccattgcg caacgcccca ggtttcttct gaagcacaga caagtaatgg
     2881 tgccagtcgt attgtgtgtg gccacgccga gcgtggccac tgccaaacaa tcttggatgc
     2941 tcggcaatgt gttggccttc ggcagccatc accagcttgt ctgcataaat ccgaaggctg
     3001 atggccctgt tggcgtaact ggcaggaacg ctgtagcgat tgccctcgtg gtgaacaagg
     3061 caggttgaag tgactcgctt ggtttgctcc acgaatgcat caaaggcatt gggtagcgcc
     3121 atcaactcgc cttgttcatc ggcaaaggcc tcttgcacgg tttggtccaa ttcggggtgg
     3181 cgcagctcag accacagcgc tttgcagcga tgctcaagcc acacattcaa atcagcaagg
     3241 ctttgaaagt ctggtgcccc ttgccacagg cgttggcggg aatcctgcac gttcttctca
     3301 atctggcctt tctcccaacc cgatgctgga ttacagaact gcgcatcaaa caggtagtgg
     3361 ctgaccatgg cagtgaaccg ctgattgacc ctgcgctctt tgccacgccc caccgaatcc
     3421 acagcggtct tcatgttgtc gtagatgccg cgcttgggaa tgccaccgaa gatttgaaag
     3481 gcatgccagt gggcatcaaa cagcatttca tgtttttgct ggtagtaagc ccgaagcaca
     3541 aaggcccggc tgtgggccaa cttaaactgg gcaatctgaa gtttgacctg tttgcccgct
     3601 atgcgggcaa agtcctcact ccaatcgaat tggaaggctt cgccacaagc aaagcgcaag
     3661 gggatgaaac aacccttgcc cgaggtttgc gccttgaact gttcggaatc tttccactgt
     3721 cgggcaaagg cacacactcg gtcataagac ccggtaaagc ccaaagcgac caaatcccgg
     3781 tacatgctgc gcaggtttct gcgcagcttc tttgtctttt tgtgctcggt ggagagccac
     3841 tgccttaact tgggctcaaa aggacttaac ttgccaacgc tgtctcgcgc tgggtactgc
     3901 ggttcaacca ccttgctttg caaatacttg cgaacggtgt tcctggacag gccgcttcgt
     3961 cgggctattt cccgaatcga cgcaccatcg cgaaaatgcc agcgtcgaat tgcgctcaat
     4021 atcgccacgt ttatcactcc ttgatttctc ccgccatatc cagacgggaa acagtgtcat
     4081 acgtgggtca aatttcgacg caaatcttta ccctaagttg gggtgcggac aaaatcttgg
     4141 actactttag gagtagttca tgtattcgta tgaagatcgc cttcgagccg tgaggttgta
     4201 cctgaagctt gggcgccgga tgagcgccac actacggcag ctgggatacc ccaccaagaa
     4261 ctcgctgaag gcctggttgg cagaattcga acggaatcag gatcttcgcc gaggctatca
     4321 acggataaaa cggcagtaca ccgatgagca aaagcaacgg gcagtagatc actatatcga
     4381 acaaggctac tgcctgagtc acacaatccg aagcctgggc tacccaagcc gcgaggcctt
     4441 gcgtgcctgg atccgtgatt tacgccctga attcgctagg acggtcgtcg gcagcagcgc
     4501 tcccacagtc gcccgctctc gcctcgagaa gcagcaagcc gtcattgcac tgaacctgcg
     4561 cgtaggttcg gcaaaggatg tggccgacac tgtcggtgta tcgcgaccaa cgttgtataa
     4621 ctggcagcat cgattacttg gcaaagtgcc cctaaaaccc atgacaaaga agaaaggtga
     4681 cacctcgctc gagcagcggc atgaggcact actcagggaa ctggccgaac tggagagcca
     4741 gaaccagcgg cttcgcatgg agaatgcaat tctggagaag gcgagtgaat tgataaaaaa
     4801 agacatgggc atcaaccccc tcgaactgac aagccgagaa aaaacgaagg tggttgatgc
     4861 cctcagagtc acgtttccat tagccaatct gttgtgcggc ctgaagctgg cgcgcagcac
     4921 atacttctat caacgcctgc ggcagacgcg gcccgacaag tacacgcagg tgcgtgaggt
     4981 cattcggact atcttcgagg acaactaccg ctgctatggc tatcgacgca ttgatagtgc
     5041 cttgcgcctt ggtggcatgc gtgtgtccga gaaggtcgtg cgtcgcttga tggcgcaaga
     5101 gcgtctggtc gtgagaacac cgcgccgccg gcgcttctcg gcgtatgctg gcgacccgac
     5161 accagcggtc ccgaatctgc tgaatcgcga ctttcacgcg tcggcgccga atacgaaatg
     5221 gttgaccgat ctgacggaaa tacacattcc ggcagggaag gtctacgtct cgccgatcgt
     5281 cgattgcttc gatgggctgg tggtggcctg gaatatcggc accagcccgg atgcgaacct
     5341 ggtcaatacc atgctggatc acgcggtacg gacactgcga cccggtgagc atccggttat
     5401 ccattcggac aggggctcgc attatcgctg gcctgcgtgg atccgccgca ctgaaaatgc
     5461 ccaattaacg cggtcgatgt ccaaaaaggg ctgctcgcca gacaatgctg catgcgaggg
     5521 ctttttcgga cgattgaaga ccgaactaat ctacccgagg aattggcagc acgtgacgct
     5581 gaaagacctc atgacgcgaa tcgatgccta tatccactgg tacaacgagc gccgcatcaa
     5641 agtgtcgctt ggcgggcgta gtcccatcga gtatcgtcat gcggtcggat tgatgtccgt
     5701 ataaaccgtc caagaaatcg tccgcacccc cagtgggtca attttagatg caactcaaca
     5761 ggccatgctg agtgtgcgat ggttgatcgc ttcctcgccg ctctccacgg cgacgatggc
     5821 cgccgccatc agcaagtgcg ccagttcccc tatggtgccc tcgctgcgtg tgagcaggta
     5881 gcgagccatg tccagcgtgg caattgggga aggccggcgc agcgggagcg aagcggcgaa
     5941 gctggccagc agtgagcagc aatcgtcgtt ggcctcccat accggcagca tcatcggctc
     6001 gaagcgattt tccaactggt catcggagcg gatggctagg taggcgtcgc gcgtgcctac
     6061 cccaaccaac gggatgcgca gttcgttgcc gaggaagcgc agcaggttga ggaattcccg
     6121 gcggttgacg ctgttgccgg ccagcacgtt gtgcagctcg tcgatcacca gcatgcgcac
     6181 gccgaccttg cgcagcagtg ccagagccag ttgctccatt tccggcaacc gtgggcgtgg
     6241 gcgcagcggc gcgcccatcg cggcgagcag cgcgacgtag aagcggatca cggacggctc
     6301 ggacggcatc tgcacgacca acaccgggat gtgctcctgg tcggcgtcgg agctggccgg
     6361 gtgggtgcgg cggaacttct cgacgatcat cgacttgcca ttgttggtcg ggccaaccag
     6421 cagcaggttg ggcatgcgtt gcttgtttgg ccacgcataa agggcttcca gccggttcag
     6481 cgcctcgact gcgcgcggat agccgatcca gcggtcggcg cgaaggcgct ggatgcgctc
     6541 gtccgccgga agacgggcca agccctgggc cgccggcagc aggtgggaca ggtcgatgat
     6601 gggatattcg tccacggcta ccactcctca atctggtcga acggtttggc gggtggcaag
     6661 ttgtctgcct gcgggtcggc aatatccgta tccggcggaa cgggcttgtc cggccgagct
     6721 gatgtcttga ggtgctggcg gcgatccgcg tcacgccgcg ccttgcgtgt ggccttctgc
     6781 gcgctggtca caatctcacg catctggccg atcatgcgga acagcgccga ctcatccacc
     6841 tgttcgcgcc cttgctgccg cagtttcgcc agcgcctgcc gttgttccca gagggtgaca
     6901 gccggatgcg acaaggtacg gtagggaatt tccaggtaat gctgtccctc cggttccagg
     6961 acccagatac ggctgatgtc gcgcggatcg cgccggatca gaaaggacgg ccagcgttca
     7021 cgccgcgcaa tccacggctt gagcgcatcg gcgtagtagt ggatgtggtc gatgacaaag
     7081 ccggtgcggg tcagcgtgcg ccggaggatc ggcagaaaat cgaccaggaa cgaagtagcg
     7141 cgtgtgacga cggccggtac gccgacacgc gccacggcct cggcccagcg cgcggccggc
     7201 ggttggagca ggccgttgtg caccgaaccg tggtaggtgc cgaccgccaa tgtgagccag
     7261 cgctctagct cgcgcagcgt cagggcggcc ttgttttcgg aatcgtagtc gccgcgctgg
     7321 tcagggttgg agaaggtcgt tcccggcagt tcgtcgtgaa tcatctgcat cgccgtgccg
     7381 atgatccgtt ccacgatgcc gccatagtgc ggctgtccca gcgggcgata gtccagccgg
     7441 atgccatgct gctcgcaacc ccggcgcagg gcctcgctct tgaactcggc cgcgttgtct
     7501 aggtagagca gcaagggctt gccgctcatc tgccaatcca tttccacgtt cagtccttcc
     7561 agccaagggc gcttgtcgca ggcgacatgc acgaggcaca ggccaaccga aacggcagac
     7621 ggcgcttcca gcgtgacgac catgccgagc acgcagcggg tgaacacgtc gatggcgagg
     7681 gtcaggtacg ggcggccaat aggttgccgg tcgcggtcat cgaccacgat caggtcgatg
     7741 accgtatggt ctatctgcac ctgctccagc ggcgcggtca cggcaggagg ctcgccgccc
     7801 acaccttgta ggtcacgagc ggcatcctgg ccttcccgcc ggcggatgac cttgcgcggg
     7861 tcaaggctag cgatccgtaa ggccacggta ttgcgcgccg gcactcgcag tttttgagcc
     7921 ttgcacacct gagtgacttc gcggtgaaag gccgctaggc tgcgcttctg cttggtcagg
     7981 aaccgctttt gcagtagctc gtggatgacg cgctcgaccg gttccggcaa gcgcccctta
     8041 cctttacctc caccggactg gccgggcacc agatccgtca cgaggccgct gccttgccgg
     8101 gcacgccgga tcagaacgta tacctggcgc cgagacaagc ccagcgcctg agccgccata
     8161 tcggccgctt cgtgcccgac cgtctccgac tgcgccaacg gactgatgat ctccgcacga
     8221 cggcgcgcac gctcccaagc ctcatcaggc agagtggcca cgccttgttc tggaatccgt
     8281 ggggtgtccg tcgccatgct cacctcgctt tggtgcacac gagtattgag catagtcgag
     8341 attggtgcag atcacttctg atattgaact gtcaggagct ggctgcacaa cagccattac
     8401 gcccaatcaa ctggtgcagt cgtcttctga aaatgacatc catgcccagc cctgcgcgag
     8461 ctggatcacc gcccgcacga tagtttggtc acggg
//

If you have problems or comments...

PBIL Back to PBIL home page