(data stored in SCRATCH zone)

EMBL: X15664

ID   X15664; SV 1; linear; genomic DNA; STD; PRO; 2437 BP.
XX
AC   X15664;
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 11)
XX
DE   B.subtilis S10/spc operon rpmC, rpsQ, rplN, rplX, rplE, rpsN genes
XX
KW   ribosomal protein L14; ribosomal protein L16; ribosomal protein L24;
KW   ribosomal protein L29; ribosomal protein L5; ribosomal protein S14;
KW   ribosomal protein S17; ribosomal protein S8; rplE gene; rplN gene;
KW   rplX gene; rpmC gene; rpsN gene; rpsQ gene; spc operon.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2437
RA   Henkin T.M.;
RT   ;
RL   Submitted (23-JUN-1989) to the INSDC.
RL   Henkin T.M., LSU Medical Centre, Dept of Biochemistry & Molecular Biology,
RL   P O Box 33932, 1501 Kings Highway, Shreweport    LA71130, U S A.
XX
RN   [2]
RP   1-2437
RX   DOI; 10.1093/nar/17.18.7469.
RX   PUBMED; 2508062.
RA   Henkin T.M., Moon S.H., Mattheakis L.C., Nomura M.;
RT   "Cloning and analysis of the spc ribosomal protein operon of Bacillus
RT   subtilis: comparison with the spc operon of Escherichia coli";
RL   Nucleic Acids Res. 17(18):7469-7486(1989).
XX
DR   MD5; 026c66436e633ff40d48fea7e1c55c56.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2437
FT                   /organism="Bacillus subtilis"
FT                   /map="12 degrees on 360 degree map"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /clone="18171"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <3..323
FT                   /transl_table=11
FT                   /note="L16 protein (AA 1-106)"
FT                   /db_xref="GOA:P14577"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14577"
FT                   /protein_id="CAA33698.1"
FT                   /translation="ASWITNRQIEAARIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRM
FT                   GSGKGAPEGWVAVVKPGKVLFEISGVSEEVAREALRLASHKLPIKTKFVKREEIGGESN
FT                   ES"
FT   CDS_pept        313..513
FT                   /transl_table=11
FT                   /note="L29 protein (AA 1-66)"
FT                   /db_xref="GOA:P12873"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12873"
FT                   /protein_id="CAA33699.1"
FT                   /translation="MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIRE
FT                   VRKAIARMKTVIREREIAANK"
FT   CDS_pept        536..799
FT                   /transl_table=11
FT                   /note="S17 protein (AA 1-87)"
FT                   /db_xref="GOA:P12874"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12874"
FT                   /protein_id="CAA33700.1"
FT                   /translation="MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKK
FT                   FKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII"
FT   CDS_pept        840..1208
FT                   /transl_table=11
FT                   /note="L14 protein (AA 1-122)"
FT                   /db_xref="GOA:P12875"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12875"
FT                   /protein_id="CAA33701.1"
FT                   /translation="MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGEVVKAVIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRENNFMKIVSLAPEVI"
FT   CDS_pept        1246..1557
FT                   /transl_table=11
FT                   /note="L24 protein (AA 1-103)"
FT                   /db_xref="GOA:P0CI78"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI78"
FT                   /protein_id="CAA33702.1"
FT                   /translation="MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHS
FT                   KPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK"
FT   CDS_pept        1584..2123
FT                   /transl_table=11
FT                   /note="L5 protein (AA 1-179)"
FT                   /db_xref="GOA:P12877"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12877"
FT                   /protein_id="CAA33703.1"
FT                   /translation="MNRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTD
FT                   EEARELLTQVGMPFQK"
FT   CDS_pept        2146..2331
FT                   /transl_table=11
FT                   /note="S14 protein (AA 1-61)"
FT                   /db_xref="GOA:P12878"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12878"
FT                   /protein_id="CAA33704.1"
FT                   /translation="MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   CDS_pept        2369..>2437
FT                   /transl_table=11
FT                   /note="S8 protein (AA 1-23)"
FT                   /db_xref="GOA:P12879"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12879"
FT                   /protein_id="CAA33705.1"
FT                   /translation="MTDPIADMLTRIRNANMVRHEKL"
XX
SQ   Sequence 2437 BP; 805 A; 457 C; 540 G; 635 T; 0 other;
     aagcttcttg gattactaac cgtcaaatcg aagctgcacg tattgcgatg actcgttaca        60
     tgaaacgtgg cggtaaagtt tggatcaaaa ttttcccttc taaaccttac actgctaaac       120
     cacttgaggt acgtatggga tccggtaaag gggctccaga aggttgggta gctgttgtaa       180
     aaccgggcaa agttttattt gaaatttctg gtgtgtctga agaggttgct cgtgaagcgc       240
     ttcgccttgc atctcacaaa ttgccaatta aaacgaagtt cgtaaaacgt gaagaaattg       300
     gtggtgaatc aaatgaaagc taatgaaatt cgtgacctta ccactgctga aattgaacaa       360
     aaagtaaagt ctcttaaaga agaacttttc aatcttcgct ttcaattagc gacaggacaa       420
     cttgaaaata ctgctcgcat tcgtgaagtg cgcaaagcta tcgcgcgcat gaaaactgtg       480
     attcgtgaaa gagaaattgc tgctaataaa taatcactga ggggaggtcg tgagcatgag       540
     cgaacgcaac caacgcaaag tttaccaagg ccgtgttgtt tctgacaaaa tggataaaac       600
     cattactgtt gttgttgaga catacaaaaa acatacactt tacggtaaac gcgtaaaata       660
     ctcaaaaaaa ttcaaagcac atgatgaaaa taatcaagct aaaatcggtg acatcgttaa       720
     gatcatggaa actcgtccat tgtctgcaac taagcgtttc cgtctagttg aagttgtcga       780
     agaagctgtt attatctaat aaagttcgga attctttttc cgaagggagg taacaaataa       840
     tgattcaaca agagactcgt ttaaaagtag ctgacaactc tggcgcacgt gaagtactta       900
     ctattaaagt tcttggtggt tctggacgta aaacagctaa cattggtgat gtaattgttt       960
     gcacggttaa acaagcaaca ccaggaggcg ttgtcaaaaa aggtgaagtc gtaaaagctg      1020
     ttatcgttcg cactaaaagc ggagcgcgca gaagtgacgg ttcatacatc agcttcgatg      1080
     agaatgcatg tgttatcatc cgtgacgaca agagcccacg cggaactcgt atcttcggac      1140
     cagttgctcg tgaattgcgt gaaaacaact ttatgaaaat tgtttctcta gctccagaag      1200
     ttatctaatt gaaataaatg ccttactcaa ggtggtgcga tcaggatgca tgtaaaaaaa      1260
     ggcgataaag ttatggttat ctctggtaaa gataaaggca aacaaggaac aatccttgct      1320
     gctttcccta aaaaggaccg cgttttagtt gaaggtgtta acatggtaaa gaaacactct      1380
     aaaccaactc aagctaaccc tcaaggcggt atttctaatc aagaggcgcc aattcatgta      1440
     tcaaacgtta tgccgctcga tcctaaaaca ggtgaagtga ctcgcgtagg atacaaagtg      1500
     gaagatggca aaaaagttcg tgtagcaaaa aaatctgggc aagttctaga taaatagtat      1560
     taaaaggaag ggaggtctat ctcatgaacc gccttaaaga aaagtacaat aaagaaattg      1620
     cacctgcttt aatgactaag ttcaactatg attcagtcat gcaagtgcct aaaatcgaaa      1680
     aaatcgtaat caacatgggt gttggtgacg ctgttcaaaa cgccaaagca atcgacagtg      1740
     ctgttgagga attaacgttt atcgcaggtc aaaaacctgt cgttactcgt gcgaagaaat      1800
     caattgctgg attccgtctt cgtgagggaa tgcctatcgg tgcgaaagta actcttcgcg      1860
     gagagcgcat gtatgatttc cttgataaac ttatttctgt atctttaccg cgtgtacgtg      1920
     acttccgcgg ggtttctaaa aaatctttcg acggtcgcgg taactacaca cttggtatca      1980
     aagaacagtt aatcttccct gaaattgact acgataaagt aacaaaggtt cgcggaatgg      2040
     acatcgttat cgtaacaact gctaatactg acgaagaagc tcgtgagcta ttaactcaag      2100
     taggtatgcc gttccagaaa taatcaatga aagggaggcg aaatcgtggc taaaaagtct      2160
     atgattgcga aacaacaacg tacaccaaag tttaaagtac aagagtacac acgctgtgaa      2220
     cgctgcggac gtccgcattc agtcattcgt aaatttaaac tttgccgtat ttgtttccgt      2280
     gagcttgcat ataaaggaca aattcctggc gtgaaaaaag ccagctggta atccccaaga      2340
     aagggaagga ggtaattata taatggttat gacagatcca attgcagata tgctaactcg      2400
     tattcgcaat gcaaacatgg tacgtcatga gaagctt                               2437
//

If you have problems or comments...

PBIL Back to PBIL home page