(data stored in ACNUC14238 zone)

EMBL: X16261

ID   X16261; SV 1; linear; mRNA; STD; ROD; 1463 BP.
XX
AC   X16261;
XX
DT   15-MAY-1990 (Rel. 24, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Rat mRNA for alternatively spliced smooth muscle myosin heavy chain (clone
DE   RAMHC15), 3' end
XX
KW   alternative splicing; cytoskeletal protein; light meromyosin;
KW   myosin heavy chain; smooth muscle myosin; smooth muscle myosin heavy chain.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1463
RA   Periasamy M.;
RT   ;
RL   Submitted (14-AUG-1989) to the INSDC.
RL   Periasamy M., University of Vermont, Dept of Physiology & Biophysics,
RL   College of Medicine, Given Bldg, Burlington, Vermont 05405, USA.
XX
RN   [2]
RP   1-1463
RA   Babuj P., Periasamy M.;
RT   ;
RL   Unpublished.
XX
DR   MD5; a6b03015f2d4153465c52e6d7f1fbe43.
XX
CC   See X16262 for alternatively spliced myosin heavy chain (clone
CC   RAMHC21).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1463
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /clone="RAMHC15"
FT                   /tissue_type="aorta (neonatal)"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        <1..840
FT                   /codon_start=1
FT                   /product="myosin heavy chain (AA 279)"
FT                   /db_xref="GOA:Q63862"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002928"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63862"
FT                   /protein_id="CAA34347.1"
FT                   /translation="ELDDARASRDEIFATSKENEKKAKSLEAELMQLQEDLAAAERARK
FT                   QADLEKEELAEELASSLSGRNTLQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVRKAT
FT                   LQAEQLSNELVTERSAAQKNESARQQLERQNKELRSKLQEVEGAVKAKLKSTVAALEAK
FT                   IVQLEEQIEQEAREKQAATKLLKQKDKKLKEVLLQVEDERKMVEQYKEQAEKGNTKVKQ
FT                   LKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREVNALKSKLRGPPPQETSQ"
XX
SQ   Sequence 1463 BP; 449 A; 346 C; 422 G; 246 T; 0 other;
     gagctggatg atgcccgtgc ctccagagat gagatctttg ccacctcaaa agagaatgag        60
     aagaaagcca agagtctgga ggcagagctc atgcagctcc aggaggacct ggcagcagct       120
     gagagagctc gcaagcaagc tgacctggag aaggaggagc tggctgagga gctggctagc       180
     agcttatcag gaaggaatac actgcaggat gagaagcgcc gcctggaggc aaggatcgcc       240
     cagctggagg aggagctgga ggaagagcag ggcaacatgg aggccatgag tgacagagtc       300
     cgcaaggcca cattgcaggc tgagcaactg agcaatgagc tggtcactga gcgcagtgca       360
     gctcagaaga atgagagtgc acggcaacag ctggagcgcc agaacaagga actccgaagc       420
     aagttgcagg aggtagaagg tgctgtcaaa gccaagctta agtccactgt tgcggcacta       480
     gaggccaaga ttgtgcagct ggaggagcag attgaacaag aggccagaga aaaacaggca       540
     gccaccaagt tgctgaagca aaaggacaag aagctaaagg aggtcctact gcaggtggag       600
     gatgagcgca agatggtgga gcagtacaag gagcaggcag agaaaggaaa caccaaggtc       660
     aagcagctca agaggcagct ggaagaggcc gaggaggaat cccagcgcat caatgccaac       720
     cgcaggaagc tgcagcggga gctggatgag gccactgaga gcaatgaggc catgggccgt       780
     gaggtgaatg ccctcaagag caaactcaga gggccccccc cacaagaaac ttcgcagtga       840
     gccaccagga gaggaaacga ggcttcattt gttccttcca gaagggctgg aggccgtaga       900
     gttattgaaa acacagatgg ttctgaagaa gaaatggatg ctcgggactc agacttcaat       960
     ggaaccaaag ccagtgaata aattcagttg gacactatgt cagggaaaac aaaataccaa      1020
     atgacagcaa agcccagcag gctgattagc atttgtctcc attcgttctc aagtcataga      1080
     cattacccca cctctcacca ggagtcaacc acagccctgc acaaaggatg tgaatttaag      1140
     tttttaaatg tgctaccaga gaaaatccag atagatgcag gtcgggagct gcagtcgcca      1200
     gtgcctttgt ttacatgaaa tggaacgtta cgtgaatggg tgccccagcg ccaacccgct      1260
     cccaaccatc aactgcctga ccttccagtt tgggaggaaa acctgtttga aaattcccct      1320
     ccctttcctg cctgcacacc tcagacacac agttcactaa gaccaagtga ctttttcagt      1380
     catctgaatt aaggaagagc agagcgagcg caccgcctta tttgcaccca cggacacttt      1440
     cacgaataaa aggttttaag tca                                              1463
//

If you have problems or comments...

PBIL Back to PBIL home page