(data stored in ACNUC14238 zone)

EMBL: X16262

ID   X16262; SV 1; linear; mRNA; STD; ROD; 2348 BP.
XX
AC   X16262;
XX
DT   15-MAY-1990 (Rel. 24, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Rat mRNA for alternatively spliced smooth muscle myosin heavy chain (clone
DE   RAMHC21)
XX
KW   alternative splicing; cytoskeletal protein; light meromyosin;
KW   myosin heavy chain; smooth muscle myosin; smooth muscle myosin heavy chain.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-2348
RA   Periasamy M.;
RT   ;
RL   Submitted (14-AUG-1989) to the INSDC.
RL   Periasamy M., University of Vermont, Dept of Physiology & Biophysics,
RL   College of Medicine, Given Bldg, Burlington, Vermont 05405, USA.
XX
RN   [2]
RP   1-2348
RA   Babuj P., Periasamy M.;
RT   ;
RL   Unpublished.
XX
DR   MD5; 96c241c8a5063799fe970a6e9063ac52.
DR   EuropePMC; PMC2936003; 20590593.
DR   EuropePMC; PMC3057298; 21175582.
DR   EuropePMC; PMC4515068; 19175686.
XX
CC   See X16261 for alternatively spliced myosin heavy chain (clone
CC   RAMHC15).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2348
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /clone="RAMHC21"
FT                   /tissue_type="aorta (neonatal)"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        <1..1866
FT                   /codon_start=1
FT                   /product="myosin heavy chain 21 (AA 621)"
FT                   /db_xref="GOA:Q63862"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002928"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63862"
FT                   /protein_id="CAA34348.1"
FT                   /translation="LDEEMEAKQNLERHVSTLNIQLSDSKKKLQDLASTIEVMEEGKKR
FT                   LQKEMEGLGQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQ
FT                   LLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEME
FT                   DLVSSKDDVGKNVHELEKSKRALETQMEEMRTQLEELEDELQATEDAKLRLEVNMQALK
FT                   GQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKKKLEGDLKDLELQ
FT                   ADSAVKGREEAIKQLRKLQAQMKDFQRELDDARASRDEIFATSKENEKKAKSLEAELMQ
FT                   LQEDLAAAERARKQADLEKEELAEELASSLSGRNTLQDEKRRLEARIAQLEEELEEEQG
FT                   NMEAMSDRVRKATLQAEQLSNELVTERSAAQKNESARQQLERQNKELRSKLQEVEGAVK
FT                   AKLKSTVAALEAKIVQLEEQIEQEAREKQAATKLLKQKDKKLKEVLLQVEDERKMVEQY
FT                   KEQAEKGNTKVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREVNALKSK
FT                   LRRGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE"
XX
SQ   Sequence 2348 BP; 732 A; 525 C; 714 G; 377 T; 0 other;
     ctggatgagg agatggaagc taagcaaaac cttgagcgcc atgtctccac cttgaacatt        60
     cagctctcag actctaagaa gaagctgcag gaccttgcaa gcactattga ggtcatggag       120
     gaggggaaga agaggttgca gaaagagatg gagggtctcg gccagcagta tgaggagaag       180
     gccgctgcct atgacaaact ggagaaaact aagaacaggc ttcagcagga gctagatgac       240
     ttggtcgtgg acttggacaa ccagcggcaa ctggtatcca atctggaaaa gaagcagaag       300
     aaattcgatc agttgttagc tgaggaaaag aacatctcct ccaagtatgc ggatgagaga       360
     gaccgagctg aagcagaggc cagggaaaag gaaacgaagg ctttgtctct ggcccgggcc       420
     ctggaggaag ccctggaagc caaagaggaa ctggaaagga ccaacaagat gctcaaggcc       480
     gagatggaag acctggtcag ctccaaggat gacgtgggca agaatgtgca cgagctggag       540
     aagtccaaac gagccctgga gacccagatg gaagagatga gaactcagct agaggagctg       600
     gaggacgagc tgcaggccac tgaagacgcc aagctgcggc tggaggtcaa catgcaggcc       660
     ctcaagggcc agtttgaacg agatctccag gctcgggatg agcagaatga ggagaagagg       720
     aggcagctac agcggcagct gcatgagtat gagacagaac tggaagatga acggaagcaa       780
     agggctctgg cggcagcagc caagaagaag ctggaagggg atctgaaaga cctggaactc       840
     caggctgact cagccgtcaa agggagggag gaagccatca agcagcttcg aaaactgcag       900
     gctcagatga aggacttcca aagagagctg gatgatgccc gtgcctccag agatgagatc       960
     tttgccacct caaaagagaa tgagaagaaa gccaagagtc tggaggcaga gctcatgcag      1020
     ctccaggagg acctggcagc agctgagaga gctcgcaagc aagctgacct ggagaaggag      1080
     gagctggctg aggagctggc tagcagctta tcaggaagga atacactgca ggatgagaag      1140
     cgccgcctgg aggcaaggat cgcccagctg gaggaggagc tggaggaaga gcagggcaac      1200
     atggaggcca tgagtgacag agtccgcaag gccacattgc aggctgagca actgagcaat      1260
     gagctggtca ctgagcgcag tgcagctcag aagaatgaga gtgcacggca acagctggag      1320
     cgccagaaca aggaactccg aagcaagttg caggaggtag aaggtgctgt caaagccaag      1380
     cttaagtcca ctgttgcggc actagaggcc aagattgtgc agctggagga gcagattgaa      1440
     caagaggcca gagaaaaaca ggcagccacc aagttgctga agcaaaagga caagaagcta      1500
     aaggaggtcc tactgcaggt ggaggatgag cgcaagatgg tggagcagta caaggagcag      1560
     gcagagaaag gaaacaccaa ggtcaagcag ctcaagaggc agctggaaga ggccgaggag      1620
     gaatcccagc gcatcaatgc caaccgcagg aagctgcagc gggagctgga tgaggccact      1680
     gagagcaatg aggccatggg ccgtgaggtg aatgccctca agagcaaact caggagagga      1740
     aacgaggctt catttgttcc ttccagaagg gctggaggcc gtagagttat tgaaaacaca      1800
     gatggttctg aagaagaaat ggatgctcgg gactcagact tcaatggaac caaagccagt      1860
     gaataaattc agttggacac tatgtcaggg aaaacaaaat accaaatgac agcaaagccc      1920
     agcaggctga ttagcatttg tctccattcg ttctcaagtc atagacatta ccccacctct      1980
     caccaggagt caaccacagc cctgcacaaa ggatgtgaat ttaagttttt aaatgtgcta      2040
     ccagagaaaa tccagataga tgcaggtcgg gagctgcagt cgccagtgcc tttgtttaca      2100
     tgaaatggaa cgttacgtga atgggtgccc cagcgccaac ccgctcccaa ccatcaactg      2160
     cctgaccttc cagtttggga ggaaaacctg tttgaaaatt cccctccctt tcctgcctgc      2220
     acacctcaga cacacagttc actaagacca agtgactttt tcagtcatct gaattaagga      2280
     agagcagagc gagcgcaccg ccttatttgc acccacggac actttcacga ataaaaggtt      2340
     ttaagtca                                                               2348
//

If you have problems or comments...

PBIL Back to PBIL home page