(data stored in ACNUC7421 zone)

EMBL: X16664

ID   X16664; SV 4; linear; genomic DNA; STD; PRO; 75812 BP.
XX
AC   X16664; AF301153; AF302690;
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 12)
XX
DE   Escherichia coli encoding determinant sfa(I)
XX
KW   ABC transport protein; adhesin; cadaverin decarboxylase;
KW   excisionase of Shigella flexneri bacteriophage X; hemin receptor;
KW   hemoglobin protease; histone; InsA protein; InsB protein;
KW   insertion element IS100; insF gene; insG gene; int gene;
KW   integrase of Shigella flexneri bacteriophage X; iroB gene; IroB protein;
KW   iroC gene; IroC protein; iroD gene; IroD protein; iroE gene; IroE protein;
KW   iroN gene; IroN protein; IS100 transposase; lysil-tRNA synthetase LysU;
KW   lysin/cadaverin transporter; MarR-family transcriptional regulator;
KW   mchF gene; microcin transport protein MchF; ORF12; ORF13; ORF33; ORF34;
KW   ORF35; ORF36; ORF37; ORF38; ORF43; ORF44; ORF45; ORF46; ORF47; ORF48;
KW   ORF49; ORF5; ORF50; ORF50 protein of pB171; ORF51; ORF51 protein of pB171;
KW   ORF52; ORF53; ORF54; ORF55; ORF56; ORF57; ORF58; ORF59; ORF6; ORF60; ORF61;
KW   ORF62; ORF63; ORF64; ORF65; ORF66; ORF67; ORF68; ORF7; pB171ORF50 gene;
KW   pB171ORF51 gene; phage integrase; protein of insertion element IS1;
KW   sfaA gene; SfaA protein, major fimbrial subunit; sfaB gene; SfaB protein;
KW   sfaC gene; SfaC protein; sfaD gene; SfaD protein; sfaE gene; SfaE protein;
KW   sfaF gene; SfaF protein; sfaG gene; SfaG protein; sfaH gene; SfaH protein;
KW   sfaS gene; SfaS protein; sfaX gene; SfaX protein; thrW gene;
KW   transfer RNA-Thr; transposase; transposase InsG of insertion element IS4;
KW   transposase of insertion element IS3; transposase ORFA; transposase ORFB;
KW   xis gene; y1093 gene; y1094 gene; z1193 gene; z1194 gene; z1195 gene.
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RX   DOI; 10.1128/IAI.69.7.4248-4256.2001.
RX   PUBMED; 11401961.
RA   Dobrindt U., Blum-Oehler G., Hartsch T., Gottschalk G., Ron E.Z.,
RA   Funfstuck R., Hacker J.;
RT   "S-Fimbria-encoding determinant sfa(I) is located on pathogenicity island
RT   III(536) of uropathogenic Escherichia coli strain 536";
RL   Infect Immun 69(7):4248-4256(2001).
XX
RN   [2]
RC   revised by [3]
RA   Hacker J.;
RT   ;
RL   Submitted (02-OCT-1989) to the INSDC.
RL   Hacker J., Inst. f. Genetik und Mikrobiologie, Univ. Wuerzburg,
RL   Roentgenring 11, 8700 Wuerzburg, GERMANY.
XX
RN   [3]
RC   revised by [4]
RA   Dobrindt U.;
RT   ;
RL   Submitted (09-NOV-2000) to the INSDC.
RL   Dobrindt U., Institut fuer Molekulare Infektionsbiologie, Univ. Wuerzburg,
RL   Roentgenring 11, 97070 Wuerzburg, GERMANY.
XX
RN   [4]
RC   revised by [6]
RA   Dobrindt U.;
RT   ;
RL   Submitted (02-JUL-2001) to the INSDC.
RL   Dobrindt U., Inst. f. Molekulare Infektionsbiologie, Univ. Wuerzburg,
RL   Roentgenring 11, 97070 Wuerzburg, GERMANY.
XX
RN   [5]
RX   DOI; 10.1128/IAI.70.11.6365-6372.2002.
RX   PUBMED; 12379716.
RA   Dobrindt U., Blum-Oehler G., Nagy G., Schneider G., Johann A.,
RA   Gottschalk G., Hacker J.;
RT   "Genetic structure and distribution of four pathogenicity islands (PAI
RT   I(536) to PAI IV(536)) of uropathogenic Escherichia coli strain 536";
RL   Infect Immun 70(11):6365-6372(2002).
XX
RN   [6]
RP   1-75812
RA   Dobrindt U.;
RT   ;
RL   Submitted (11-FEB-2003) to the INSDC.
RL   Dobrindt U., Inst. f. Molekulare Infektionsbiologie, Univ. Wuerzburg,
RL   Roentgenring 11, 97070 Wuerzburg, GERMANY.
XX
DR   MD5; f4a7f8c2dfa37de81d8133286ca7594b.
DR   EuropePMC; PMC130402; 12379716.
DR   EuropePMC; PMC134923; 11889106.
DR   EuropePMC; PMC140941; 12506201.
DR   EuropePMC; PMC154688; 12734257.
DR   EuropePMC; PMC3475034; 22867028.
DR   EuropePMC; PMC400636; 15126470.
DR   EuropePMC; PMC529066; 15547285.
DR   EuropePMC; PMC535231; 15583263.
DR   EuropePMC; PMC540180; 15634952.
DR   EuropePMC; PMC5539235; 28765569.
DR   EuropePMC; PMC98161; 11254589.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00124; IS102.
DR   StrainInfo; 345468; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..75812
FT                   /organism="Escherichia coli"
FT                   /strain="536"
FT                   /isolate="uropathogenic"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:562"
FT   tRNA            4..79
FT                   /gene="thrW"
FT                   /product="transfer RNA-Thr"
FT   misc_feature    34..81
FT                   /note="48-bp direct repeat at the left border of
FT                   pathogenicity island III(536)"
FT   misc_feature    80..89
FT                   /note="bacteriophage P22 attachment site"
FT   CDS_pept        complement(94..1254)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /product="integrase of Shigella flexneri bacteriophage X"
FT                   /db_xref="GOA:Q93K89"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K89"
FT                   /protein_id="CAC43408.1"
FT                   /translation="MSIKLRGGTWHCDFVAPDGSRVRRSLETSDKRQAQELHDRLKAEA
FT                   WRVKNLGESPKKLFKEACIRWLREKSDKKSIDDDKSIISFWMLHFRETILSDITTEKIM
FT                   EAVDGMENRRHRLNWEMSRDRCLRLGKPVPEYKPKLASKGTKTRHLAILRAILNMAVEW
FT                   GWLDRTPKISTPRVKNGRIRWLTEEESKRLFAEIAPHFFPVVMFAITTGLRRSNVTDLE
FT                   WSQVDLDKKMAWMHPDETKAGNAIGVPLNETACQILRKQQGLHKRWVFVHTKPAYRSDG
FT                   TKTAAVRKMRTDSNKAWKGALKRAGISNFRFHDLRHTWASWLVQSGVSLLALKEMGGWE
FT                   TLEMVQRYAHLSAGHLTEHASKIDAIISRNGTNTAQEENVVYLNVR"
FT   CDS_pept        complement(1131..1478)
FT                   /transl_table=11
FT                   /gene="xis"
FT                   /product="excisionase of Shigella flexneri bacteriophage X"
FT                   /db_xref="GOA:Q93K88"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K88"
FT                   /protein_id="CAC43409.1"
FT                   /translation="MEEEIFTREEAASYLKVDKGTITQWIRSGRLQAAKINPDKPKSPY
FT                   RICKSDCIAALKSVRHNSAVNAVDVQEVKACQSNYAVARGTVISSRQMDQELDALLKHR
FT                   TKGKRKNFTIV"
FT   CDS_pept        2210..3232
FT                   /transl_table=11
FT                   /gene="y1094"
FT                   /product="IS100 transposase; transposase ORFA"
FT                   /function="possibly involved in DNA transposition"
FT                   /db_xref="GOA:Q93K87"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K87"
FT                   /protein_id="CAC43410.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHPSENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   CDS_pept        3232..4011
FT                   /transl_table=11
FT                   /gene="y1093"
FT                   /product="IS100 transposase; transposase ORFA"
FT                   /function="possibly involved in DNA transposition"
FT                   /db_xref="GOA:P74994"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:P74994"
FT                   /protein_id="CAC43411.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   CDS_pept        complement(4062..5813)
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF5"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K86"
FT                   /protein_id="CAC43412.1"
FT                   /translation="MYFPLIHYGIIYCDTLLSHPQKHLPKRKLTAGQSFAGLAWKQYHV
FT                   TDTAQHRLHLRRFVNMNQPHADNLQGQHPDRAICSADEDQYGFIHIATQLAVAVKGIGR
FT                   EGSAVIGIEGPWGSGKTSLLNLLRNALVEQIEECTFVLTISPWLDGSNTSLVASLLLPV
FT                   ANIIAAEEEQRLAPEERAALRRRKSLTRTAKTMIDYTRATARNLATVASAAAVIPGVPD
FT                   ASGALKALSETRWLKEKEKTTAEMRTEIAKKIDELDLSFIVLLDDLDRLEPAQAVEVIR
FT                   LVKSVGDFPRFRYLLCYDKAILSQAISLGLGVPDGNLYLQKIVQISFCLPRPETFVLRR
FT                   KFRDAAAALYRKVNGHAPDRIVLEQLTQVADVYGAALKTPREVQMVLNALTFLYPGMRD
FT                   YVYFPDLCFLQLLRTTNAGLYDWVEEYLSERAVVAAGDGHVSELEQAEMAESLKSHLAR
FT                   YFPAEAHAVHALARWVPGITGWKTDSPIKLFVPTPEQDSALLTAGKRLGSQAYWLYYFA
FT                   FSAPQNVLSPEMLNEIFDIAGYPEQQHRLAERLLGYIQSKGLSSRTWFEHILTQLTTQQ
FT                   IATVNDG"
FT   CDS_pept        complement(6585..6773)
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q83WA3"
FT                   /protein_id="CAD66177.1"
FT                   /translation="MHSLKTLLQLPCGWRCSRQIISSDGITLHLHGKRKTAQCPECFKR
FT                   SDSVHSCRRRRIQHLPC"
FT   CDS_pept        7334..8368
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF7"
FT                   /db_xref="GOA:Q93K85"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K85"
FT                   /protein_id="CAC43413.1"
FT                   /translation="MQSVSKSIYRGKLLGSLPAVGEIHKEIAVSEETVTWISLQREIIA
FT                   NILLGKDPRLLVIVGPCSIHDVQAAVEYAKRLSVLQNKYLSQMYIVMRTYFEKPRTRKG
FT                   WKGIMHEPDLNGSYNVEKGIRYARQCLSSITTMRVATATEFLDPFLTPYIADLICWGAV
FT                   GARTTESQTHRQLASGLHCPVGFKNSTDGNINLAIDAILAAREQHVVYMTSLTKCISTL
FT                   LTDGNPHGHLILRGGREPNYGLSDITKAVKLMHDEGINHRLIIDCSHGNSGKVAERQIS
FT                   VAREVIDNRKKMPGYVAGIMLESFLQGGKQSDSLPREYGQSVTDECLSWQQTEQLLSTL
FT                   AAQL"
FT   CDS_pept        complement(9245..10099)
FT                   /transl_table=11
FT                   /gene="insF"
FT                   /product="transposase of insertion element IS3"
FT                   /db_xref="GOA:Q93K84"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K84"
FT                   /protein_id="CAC43414.1"
FT                   /translation="MKYVFIENHRAEFSIKAMCRVLRVARSGWYVWLRRRHQMSLRQQF
FT                   RLTCDAAVHKAFFEAKQRYGAPRLADEMPEFNIKTIAASLRRQGLRAKASRKFSPVSYR
FT                   AHGLPVLENLLEQDFSASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPR
FT                   MTAQLACDALQMALWRRRRPESVIVHTDRGGQYCSGDYQALLKRHNLRGSMSAKGYCYD
FT                   NACVESFFHSLKVECIHGERFSSREIMRATVFNYIECDYNRWRRHSACGGLSPEQFENH
FT                   NLA"
FT   CDS_pept        complement(10096..10395)
FT                   /transl_table=11
FT                   /gene="yis1_SHISO"
FT                   /product="hypothetical protein of insertion element IS1"
FT                   /db_xref="GOA:Q83WA2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q83WA2"
FT                   /protein_id="CAD66178.1"
FT                   /translation="MTKPVSISKKPRKQHTPEFRNEALKLAERIGVAAAARELSLYESQ
FT                   LYAWCSKQQQQMSSSERESELAAENVRLKRQLAEQAEELAILQKAATYFAKRLK"
FT   CDS_pept        10491..11546
FT                   /transl_table=11
FT                   /gene="mchF"
FT                   /product="microcin transport protein MchF"
FT                   /function="involved in transport"
FT                   /db_xref="GOA:Q93K83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K83"
FT                   /protein_id="CAC43415.1"
FT                   /translation="MVYVLIRLVTYGYYRQISEETLVRGARASSYFMESLYGIATVKIQ
FT                   GMVGIRGTHWLNLKIDAINSGIKLTRMDLLFGGINTFVAACDQMAILWLGASLVIDNQM
FT                   TIGMFVAFGSFRGQFSDRVASLTSFLLQLRIMSLHNERIADIALHEKEEKKPEIEIVAD
FT                   MSPVSLETTDLSYRYDSQSAQVFSGLNLSVAPGESVAITGASGAGKTTLMKVLCGLFEP
FT                   DSGKVLVNGTDIRQLGINNYHRMIACVMQDDRLFSGSIRENICGFAEETDDEWMTECAR
FT                   ASHIHDVIMKMPMGYETLIGELGEGLSGGQKQRIFIARALYRKPGILFMDEATSSLDTE
FT                   SERFVNAAIKK"
FT   CDS_pept        11653..11874
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="OR11"
FT                   /db_xref="GOA:Q93K82"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K82"
FT                   /protein_id="CAC43416.1"
FT                   /translation="MGEVKKDIKITVIAFVINYLFFYIPVSLYLIYYYGYNFFNLYMFF
FT                   LSLVVTFLSLWLNVNFYFFTNLIAKVLK"
FT   CDS_pept        11871..12149
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF12"
FT                   /db_xref="InterPro:IPR020280"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K81"
FT                   /protein_id="CAC43417.1"
FT                   /translation="MRKLSENEIKQISGGDGNDGQAELIAIGSLAGTFISPGFGSIVGA
FT                   YIGDKVHSWATTATVSPSMSPSGIGLSSQFGSGRGTSSASSSAGSGS"
FT   CDS_pept        complement(12326..13012)
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF13"
FT                   /db_xref="GOA:Q93K80"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K80"
FT                   /protein_id="CAC43418.1"
FT                   /translation="MEITKNKNATIKKQSSPGCFSMFTLSFSITFIPAFLTNRQELISR
FT                   GLLVPALFLAEFLILVPLYFIFFRKREGLGRGSFRLDVFFTLFSLIMIIQLFVPYLLAV
FT                   RKTEEWMISQMSFSGAILWINIFSSVLLVPVYEEIVFRGCLFNSFKSWFNDNICISAIV
FT                   TSVIFSALHLQYTDFRTFLMLFLVSLVLISAKIKSNGLLMPILLHMSMNAVIAGIQYLA
FT                   YISYTH"
FT   CDS_pept        complement(13107..13577)
FT                   /transl_table=11
FT                   /gene="z1193"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K79"
FT                   /protein_id="CAC43419.1"
FT                   /translation="MSCYMKIYWTRKSIPELSALPPSLRKKNFTDAYNAASSHIEYWIG
FT                   AGVSFISMMILFRVYDFLLPAQDTFPGDIIRSLCVVCPSILIWFQFSVYVMRKYYRHIL
FT                   ERGKETETISERLIREADTREYELWRPVRRFFSIIFLIVLLVCIHSLITTIK"
FT   CDS_pept        14086..14535
FT                   /transl_table=11
FT                   /gene="z1194"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR016957"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K78"
FT                   /protein_id="CAC43420.1"
FT                   /translation="MDHWPNLLAFHFTLYSAEGNINGQQIHAFCTAFYRQVQEHITERN
FT                   HTASPAPPVVLRWLREQHGGATIRCLLLLSQASICHLRVSATVDEECSQVVDLLQQAWR
FT                   GINAGGQCRVERCFRVTWPDTSEQYVALKTAVQSLIPLVIATIIR"
FT   CDS_pept        14987..15346
FT                   /transl_table=11
FT                   /gene="z1195"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K77"
FT                   /protein_id="CAC43421.1"
FT                   /translation="MVGSENTSSPWQQIAREVKAPRERLKYALETGLQVIALNGLFWSD
FT                   SQRLVVDILRLSANRRDTGNRPHPHLPSYITGADTESMVVRDSVWQPREQRPEVIDRSL
FT                   APGYVCSPRTDRLSL"
FT   CDS_pept        complement(15621..15842)
FT                   /transl_table=11
FT                   /gene="sfaC"
FT                   /product="SfaC protein"
FT                   /function="involved in regulation of Shigella fimbriae
FT                   expression"
FT                   /db_xref="GOA:Q9EXJ8"
FT                   /db_xref="InterPro:IPR006793"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EXJ8"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC16949.1"
FT                   /translation="MQNEIMGFLSRHNVGKTAEIAEALAVTDYQARYYLLLLEKEGMVQ
FT                   RSPLRRGMATYWFLKGEMQAGQSCSSTT"
FT   CDS_pept        16261..16590
FT                   /transl_table=11
FT                   /gene="sfaB"
FT                   /product="SfaB protein"
FT                   /function="involved in regulation of Shigella fimbriae
FT                   expression"
FT                   /db_xref="GOA:Q93K76"
FT                   /db_xref="InterPro:IPR004356"
FT                   /db_xref="PDB:3M8J"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K76"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC43422.1"
FT                   /translation="MAQHEVITRGGDAFLLKLRESALSSGSMSEEQFFLLIGISSIHSD
FT                   RVILAMKDYLVSGHSRKDVCEKYQMNNGYFSTTLGRLTRLNVLVARLAPYYTDSVSAIA
FT                   EAASL"
FT   CDS_pept        16964..17509
FT                   /transl_table=11
FT                   /gene="sfaA"
FT                   /product="SfaA protein, major fimbrial subunit"
FT                   /function="structural protein of Shigella fimbriae"
FT                   /db_xref="GOA:Q93K75"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K75"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC16950.2"
FT                   /translation="MKLKFISMAVFSALTLGVATNASAVTTVNGGTVHFKGEVVDAACA
FT                   VNTNSANQTVLLGQVRSAKLANDGEKSSPVGFSIELNDCSSATAGHASIIFAGNVIATH
FT                   NDVLSLQNSAAGSATNVGIQILDHTGTAVQFDGVTASTQFTLTDGTNKIPFQAVYYATG
FT                   KSTPGIANADATFKVQYQ"
FT   CDS_pept        17580..18119
FT                   /transl_table=11
FT                   /gene="sfaD"
FT                   /product="SfaD protein"
FT                   /function="involved in transport and assembly of Shigella
FT                   fimbriae subunits"
FT                   /db_xref="GOA:Q9EXJ7"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EXJ7"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC16951.1"
FT                   /translation="MKISKMAVMLFLLPPAALAGNHWHVMLPGGNMRFQGKIIAEACSL
FT                   ALSDRQMTVDMGQLSSNRFHAAGEYGDPVGFDIHLQDCSTVVSQRVGISFYGVSDIHEP
FT                   ELLSVEEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPV
FT                   AGGKANGQVWFSLTYL"
FT   CDS_pept        18160..18855
FT                   /transl_table=11
FT                   /gene="sfaE"
FT                   /product="SfaE protein"
FT                   /function="involved in transport and assembly of Shigella
FT                   fimbriae subunits"
FT                   /db_xref="GOA:Q9EXJ6"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EXJ6"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC16952.2"
FT                   /translation="MMKHMRIWAVLASFLVFFYIPQSYAGVALGATRVIYPEGQKQVQL
FT                   AVTNNDDKSSYLIQSWIENAEGKKDARFVITPPLFSMQGKKENTLRIIDATNGQMPEDR
FT                   ESLFWVNVKAIPAMDKAKTGENYLQFAIVSRIKLLYRPQGLVIPPEQAPGKLEFTRENG
FT                   GLTLFNPTPYYLTVTDLKAGNKSLENTMVPPQGKVTVNIPGGYTGGDITYKTINDYGAL
FT                   TEQVRGVVK"
FT   CDS_pept        18926..21556
FT                   /transl_table=11
FT                   /gene="sfaF"
FT                   /product="SfaF protein"
FT                   /function="involved in transport and assembly of Shigella
FT                   fimbriae subunits"
FT                   /db_xref="GOA:Q9EXJ5"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EXJ5"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC16953.2"
FT                   /translation="MFSGDGGQLLSDKSLTGSAGGGNNRMRFNILPLAFFIGIIVSPAR
FT                   AELYFNPRFLSDDPDAVADLSAFTQGQELPPGVYRVDIYLNDTYISTRDVQFQMSQDGK
FT                   QLAPCLSPEHMSAMGVNRYAVPGMERLPADTCTSLNSMIQGATFRFDVGQQRLYLTVPQ
FT                   IYMSNQARGYIAPEYWDNGITAALLNYDFSGNRVRDSYGGTSDYAYLNLKTGLNIGSWR
FT                   LRDNTSWSYSAGKGYSQNNWQHINTWLERDIVPLRSRLTMGDSYTRGDIFDGVNFRGIQ
FT                   LASDDNMVPDSQRGYAPTIHGISRGTSRISIRQNGYEIYQSTLPPGPFEINDIYPAGSG
FT                   GDLQVTLQEADGSVQRFNVPWSSVPVLQREGHLKYALSAGEFRSGGHQQDNPRFAEGTL
FT                   KYGLPAGWTVYGGAWIAERYRAFNLGVGKNMGWLGAVSLDATRANARLPDESRYDGQSY
FT                   RFLYNKSLTETGTNIQLIGYRYSTRGYFSFADTAWKKMSGYSVLTQDGVIQIQPKYTDY
FT                   YNLAYNKRGRVQVSISQQTGESSTLYLSGSHQSYWGTDRTDRQLNAGFNSSVNDISWSL
FT                   NYSLSRNAWQHETDRILSFDVSIPFSHWMRSDSTSAWRNASARYSQTLEAHGQAASTAG
FT                   LYGTLLEDNNLGYSIQSGYTRGGYEGSSKTGYASLNYRGGYGNASAGYSHSGGYRQLYY
FT                   GLSGGILAHANGLTLSQPLGDTLILVRAPGASDTRIENQTGVSTDWRGYAVLPYATDYR
FT                   ENRVALDTNTLADNVDIENTVVSVVPTHGAVVRADYKTRVGVKVLMTLMRNGKAVPFGS
FT                   VVTARNGGSSIAGENGQVYLSGMPLSGQVSVKWGSQTTDQCTADYKLPKESAGQILSHV
FT                   TVSCR"
FT   CDS_pept        21569..22096
FT                   /transl_table=11
FT                   /gene="sfaG"
FT                   /product="SfaG protein"
FT                   /function="minor Shigella fimbriae subunit"
FT                   /db_xref="GOA:P13429"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13429"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA34652.1"
FT                   /translation="MVKDIIKTVTFSCMLAGSMFVTCHVCAAGSVVNITGNVQDNTCDV
FT                   DINSRNFDVSLGSYDSRQFTAAGDTTPASVFHVGLTSCGSAVRAVKLTFTGTPDNQEAG
FT                   LIQINSINGARGVGIQLLDKDKHELKINVPTTIALMPGTQTIAFYARLKATYLPVKAGN
FT                   VDAVVNFVLDYQ"
FT   CDS_pept        22118..22609
FT                   /transl_table=11
FT                   /gene="sfaS"
FT                   /product="SfaS protein"
FT                   /function="adhesin, minor Shigella fimbriae subunit"
FT                   /db_xref="GOA:P13430"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13430"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA34653.1"
FT                   /translation="MKLKAIILATGLINCIAFSAQAVDTTITVTGNVLQRTCNVPGNVD
FT                   VSLGNLYVSDFPNAGSGSPWVNFDLSLTGCQNMNTVRATFSGTADGQTYYANTGNAGGI
FT                   KIEIQDRDGSNASYHNGMFKTLNVQNNNATFNLKARAVSKGQVTPGNISSVITVTYTYA
FT                   "
FT   CDS_pept        22671..23570
FT                   /transl_table=11
FT                   /gene="sfaH"
FT                   /product="SfaH protein"
FT                   /function="minor Shigella fimbriae subunit"
FT                   /db_xref="GOA:P13431"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR015243"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13431"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA34654.2"
FT                   /translation="MAYSQPSFALLCRNNQTGQEFNSGDTSFRVNVSPVVQYDKSISVL
FT                   DLSQLVSCQNEDSTGQNYDYLKILKGSGFSPALDTKTYGRLDFTSRPTGYARQLPLQFD
FT                   LQVTEAFYQYGVWKPFPAKLYLYPEPGVFGKVINNGDLLATLYVNKFSTKGQEAGERNF
FT                   TWRFYATNDVHIQTGTCRVSSNNVKVDLPSYPGGPVTVPLTVRCDQTQSVSYTLSGPVT
FT                   GSGNTVFANTAASGAGGVGVQLSDKAGPVPAGQPRSLGQVGSSPVSLGLKASYALTGQA
FT                   SLTPGAVQSVINVTFSYN"
FT   CDS_pept        24811..25311
FT                   /transl_table=11
FT                   /gene="sfaX"
FT                   /product="SfaX protein"
FT                   /function="transcriptional regulator"
FT                   /db_xref="GOA:Q93K74"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K74"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC43423.1"
FT                   /translation="MNNTDTLEKIIRHQKNKDPAYPFREHLLMQLCIRANKRMQDNISE
FT                   FLGAYGINHSVYMVLTTLFTAESHCLSPSEISQKLQFTRTNITRITDFLEKTGYVKRTD
FT                   SREDRRAKKISLTSEGMFFIQRLTLAQSMYLKEIWGYLTHDEQELFEVINKKLLEHLDD
FT                   VSS"
FT   CDS_pept        25805..27982
FT                   /transl_table=11
FT                   /gene="iroN"
FT                   /product="IroN protein"
FT                   /function="siderophore receptor"
FT                   /db_xref="GOA:Q93K73"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K73"
FT                   /protein_id="CAC43424.1"
FT                   /translation="MRINKILWSLTVLLVGLNSQVSVAKYSDDDNDETLVVEATAEQVL
FT                   KQQPGVSVITSEDIKKTPPVNDLSDIIRKMPGVNLTGNSASGTRGNNRQIDIRGMGPEN
FT                   TLILIDGVPVTSRNSVRYSWRGERDTRGDTNWVPPEQVERIEVIRGPAAARYGSGAAGG
FT                   VVNIITKRPTNDWHGSLSLYTNQPESSEEGATRRANFSLSGPLAGDALTTRLYGNLNKT
FT                   DADSWDINSPVGTKNAAGHEGVRNKDINGVISWKLNPQQILDFEAGYSRQGNIYAGDTQ
FT                   NSSSSAVTESLAKSGKETNRLYRQNYGITHNGIWDWGQSRFGIYYEKTNNTRMNEGLSG
FT                   GGEGRILAGEKFTTNRLSSWRTSGELNIPLNVMVDQTLTVGAEWNRDKLDDPSSTSLTV
FT                   NDRDISGISGSAADRSSKNHSQISALYIEDNIEPVPGTNIIPGLRFDYLSDSGGNFSPS
FT                   LNLSQELGDYFKVKAGVARTFKAPNLYQSSEGYLLYSKGNGCPKDITSGGCYLIGNKDL
FT                   DPEISVNKEIGLEFTWEDYHASVTYFRNDYQNKIVAGDNVIGQTASGAYILKWQNGGKA
FT                   LVDGIEASMSFPLVKDRLNWNTNATWMITSEQKDTGNPLSVIPKYTINNSLNWTITQAF
FT                   SANVNWTLYGRQKPRTHAETRSEDTGGLSGKELGAYSLVGTNFNYDINKNLRLNVGVSN
FT                   ILNKQIFRSSEGANTYNEPGRAYYAGVTASF"
FT   CDS_pept        complement(28027..28983)
FT                   /transl_table=11
FT                   /gene="iroE"
FT                   /product="IroE protein"
FT                   /function="putative hydrolase"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K72"
FT                   /protein_id="CAC43425.1"
FT                   /translation="MYAREYRSTRPHKAIFFHLSCLTLICSAQVYAKPDMRPLGPNIAD
FT                   KGSVFYHFSATSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDELLK
FT                   QLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAESRKTDLHSGRFSRKSGGSNNFRQL
FT                   LETRIAPKVEQGLNIDRQRRSLWGHSYGGLFVLDSWLSSSYFRSYYSASPSLGRGYDAL
FT                   LSRVTAVEPLQFCAKHLAIMEGSATQGDNRETHAVGVLSKIHTTLTILKDKGVNAVFWD
FT                   FPNLGHGPMFNASFRQALLDISGENANYTAGCHELSH"
FT   CDS_pept        complement(29068..30297)
FT                   /transl_table=11
FT                   /gene="iroD"
FT                   /product="IroD protein"
FT                   /function="putative ferric enterochelin esterase"
FT                   /db_xref="GOA:Q93K71"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K71"
FT                   /protein_id="CAC43426.1"
FT                   /translation="MLNMQQHPSAIASLRNQLAAGHIANLTDFWREAESLNVPLVTPVE
FT                   GAEDEREVTFLWRARHPLQGVYLRLNRVTDKEHVEKGMMSALPETDIWTLTLRLPASYC
FT                   GSYSLLEIPPGTTAETIALSGGRFATLAGKADPLNKMPEINVRGNAKESVLTLDKAPAL
FT                   SEWNGGVHTGQLLTSMRIIAGKSRQVRLYIPDIDISQPLGLVVLPDGETWFDHLGVCAA
FT                   IDAAINNRRIVPVAVLGIDNINEHERTEILGGRSKLIKDIAGHLLPMIRAEQPQRQWAD
FT                   RSRTVLAGQSLGGISALMGARYAPETFGLVLSHSPSMWWTPERTSRPGLFSETDTSWVS
FT                   EHLLSAPPQGVRISLCVGSLEGSTVPHVQQLHQRLITAGVESHCAIYTGGHDYAWWRGA
FT                   LIDGIGLLQG"
FT   CDS_pept        complement(30401..34060)
FT                   /transl_table=11
FT                   /gene="iroC"
FT                   /product="ABC transport protein"
FT                   /db_xref="GOA:Q93K70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q93K70"
FT                   /protein_id="CAC43427.2"
FT                   /translation="MPANHTPTPAQSWIVCLARVCWERKKLSVIVVVASVSTILLAALT
FT                   PLLTRQAVNDALAGNPARLPWLACGLLLIAFFDFIGNYVRRGYAGMLSLWVQHTLRGRV
FT                   FDSIQKLDGAGQDALRTGQVISRTNSDLQQVHTLLQMCPVPLAVFTYYIAGIAVMLWMS
FT                   PAMTLIVVCVLVCLAITALRARRRVFAQTGMASDQLANLTEHIREVLAQISVVKSCVAE
FT                   MRETHWLDRQSRQIVRVRIGAVISQAMPGATMLALPVLGQIVLLCYGGWSVMHGRIDLG
FT                   TFVAFASFLAMLTGPTRVLASFLVIAQRTQASAERVFALIDTRSQMEDGTESINSQVVG
FT                   LELENMSFDYHHGDRHILSDISFSLRAGETVAVVGASGSGKSTLLMLLARFYDPCSGKI
FT                   WLNTSEGRQNLRDIRLEALRRRVGIVFEDAFLFAGTVAENIAYGHPQATADDIRRAAAA
FT                   AGASDFINALPKGFDSLLTERGTNLSGGQRQRIALARALITAPDVLILDDTTSAVDAVT
FT                   EAEINTALGRYADEGHMLLVIARRRSTLQLASRVVVLDKGRMVDTGTPAELEARCPAFR
FT                   ALMTGDSDFLATSHNSHNELWPAEPATQDDVTDTGDKGFVARMTRVPENAVQQALAGKG
FT                   RKVTSLLKPVAWMFVIAALLIALDSAAGVGVLILLQHGIDSGVAAGDMSTIGLCALLAL
FT                   CLVIVGWCSYSLQTVFAARAAESVQHSVRLRSFGHMLRLGLPWHEKHADSRLTRMTVDV
FT                   DSLARFLQNGLAGAATSLVTMFAIAATMFWLDPILALTALSAVPVAALATMIYRRLSTP
FT                   AYAQARLEIGKVNSTLQEKVSGLRVVQSHGQQELEGARLRALSERFRATRVRAQKYLAV
FT                   YFPFLTFCTEASYAAVLLVGASQVAAGEMTAGVLAAFFLLLGQFYGPVQQLSGIVDAWQ
FT                   QATASGKHIDELLATEGTENLGSSSVLPVTGALHLDEVTFSYPDSHEPALNKLTLTIPE
FT                   GMVVAVVGRSGAGKSTLIKLIAGLYFPTHGNIRIGVQMLDDASLTEYRRQIGLVDQDVA
FT                   LFSSDIAENIRYSRPSATNEDVEIASQRAGLYEMVCNLPQGFRTPVNNGGADLSAGQRQ
FT                   LIALARAQLANAHILLLDEATSCLDRTSEERLMSSLTDVVHAGKHSALIVAHRLTTAQR
FT                   CDLIAVIDKGLLAEYGTHEQLLSAGGLYTRLWHDSVSSTALHRQHNMKEETPG"
FT   CDS_pept        complement(34200..35315)
FT                   /transl_table=11
FT                   /gene="iroB"
FT                   /product="IroB protein"
FT                   /function="putative glycosyl transferase"
FT                   /db_xref="GOA:Q83WA1"
FT                   /db_xref="InterPro:IPR010610"
FT                   /db_xref="UniProtKB/TrEMBL:Q83WA1"
FT                   /protein_id="CAD66179.1"
FT                   /translation="MRILFVGPPLYGLLYPVLSLAQAFRVNGHEVLIASGGQFAQKAAE
FT                   AGLVVFDAAPGLDSEAGYRHHEAQRKKSNIGTQMGNFSFFSEEMADHLVEFAGHWRPDL
FT                   IIYPPLGVIGPLIAAKYDIPVVMQTVGFGHTPWHIRGVTRSLTDAYRRHNVGATPRDMA
FT                   WIDVTPPSMSILENDGEPIIPMQYVPYNGGAVWEPWWERRPERKRLLVSLGTVKPMVDG
FT                   LDLIAWVMDSASEVDAEIILHISANARSDLRSLPSNVRLVDWIPMGVFLNGADGFIHHG
FT                   GAGNTLTALHAGIPQIVFGQGADRPVNARVVAERGCGIIPGDVGLSSNMINAFLNNRSL
FT                   RKASEEVAAEMAAQPCPGEVAKSLITMVQKG"
FT   CDS_pept        complement(36163..36522)
FT                   /transl_table=11
FT                   /gene="insG"
FT                   /product="transposase InsG of insertion element IS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q83WA0"
FT                   /protein_id="CAD66180.1"
FT                   /translation="MQLSRLTLRSKKPELVEQELWGVLLAYNLVRYQMIKMAEHLKGYW
FT                   PNQLSFSESCGMVMRMLMTLQGASPGRIPELMRDLASMGQLVKLPTRRERAFPRVVKER
FT                   PWKYPTAPKKSQSVA"
FT   CDS_pept        37437..37715
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF33"
FT                   /db_xref="GOA:Q83W99"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W99"
FT                   /protein_id="CAD66181.1"
FT                   /translation="MNDLSFIRFFLAILLLLVPPALEFSVIHRHITPGALTLCVITALI
FT                   ITLLASLGGRLVSVKCISEISFIRRHRIECMMAGFMIYFWTFSLIAG"
FT   CDS_pept        complement(38436..38780)
FT                   /transl_table=11
FT                   /product="putative transposase"
FT                   /function="involved in DNA transposition"
FT                   /note="ORF34"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W98"
FT                   /protein_id="CAD66182.1"
FT                   /translation="MQTRDNLERMVVIKAFIAVRVLGLRQEGISEETQNDSCKKILTPT
FT                   EWKLLWVKLEGKQLPSQTPTLKWACLKLGRWHDSKRTGRPGWVVMWDGWFRLQDMVEGY
FT                   PVMKSLDQEI"
FT   CDS_pept        complement(38906..39799)
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF35"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W97"
FT                   /protein_id="CAD66183.1"
FT                   /translation="MVLSDCYSWDNEQSGHARLGDPRRTRRLVSLTSSPAQHAGLSIVK
FT                   SSQSTAQVEGAYRLIRNPSVSPQAIAEAGFTATVRACEAHPLLLALEDTTTINFSHSTA
FT                   SDDQGNTTTNPKTHGLLAHSVLMYAPDSALPVGFIEQQRWSRVTDTYGVKHQRKERPCE
FT                   EKESYRWQQASERMAERLGEIQKRVITVCDREADIWHYLHYKVSHGQRFVVRAAQNSRL
FT                   EEAPGKLFELPEVLATAGSHTLNVMQKGGRAARQARMFIRYSEVSIKIATTAARRSRSR
FT                   MSVAGSSQRTVPAGIC"
FT   CDS_pept        40145..42115
FT                   /transl_table=11
FT                   /product="putative hemin receptor"
FT                   /note="ORF36"
FT                   /db_xref="GOA:Q83W96"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W96"
FT                   /protein_id="CAD66184.1"
FT                   /translation="MYMNVIRTVICTLIILPVGLQAATSHSSMVKDTITIVATGNQNTV
FT                   FETPSMVSVVTNDTPWSQNAVTSAGMLKGVAGLSQTGAGRTNGQTFNLRGYDKSGVLVL
FT                   VDGVRQLSDMAKSSGTYLDPALVKRIEVVRGPNSSLYGSGGLGGVVDFRTADAADFLPP
FT                   GETNGLSLWGNIASGDHSTGSGLTWFGKTGKTDALLSVIMRKRGNIYQSDGEHAPNKEK
FT                   PAALFAKGSVGITDSNKAGASLRLYRNNTTEPGNSTQTHGDSGLRDRKTVQNDVQFWYQ
FT                   YAPVDNSLINVKSTLYLSDITIKTNGHNKTAEWRNNRTSGVNVVNRSHTLIFPGAHQLS
FT                   YGAEYYRQQQKPEGSATLYPEGNIDFTSLYFQDEMTMKSYPVNIIVGSRYDRYKSFNPR
FT                   AGELKAERLSPRAAISVSPTDWLMMYGSISSAFRAPTMAEMYRDDVHFYRKGKPNYWVP
FT                   NLNLKPENNITREIGAGIQLDGLLTDNDRLQLKGGYFGTDARNYIATRVDMKRMRSYSY
FT                   NVSRARIWGWDMQGNYQSDYVDWMLSYNRTESMDASSREWLGSGNPDTLISDISIPVGH
FT                   RGVYAGWRAELSASATHVKKGDPHQAGYTIHSFSLSYKPVSVKGFEASVTLDNAFNKLA
FT                   MNGKGVPLSGRTVSLYTRYQW"
FT   CDS_pept        42134..42925
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF37"
FT                   /db_xref="GOA:Q83W95"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W95"
FT                   /protein_id="CAD66185.1"
FT                   /translation="MMKNTGYILALCLTASGHVLAHDVWITGKQAENNVTAEIGYGHNF
FT                   PSKGTIPDRRDFFENPRLYNGKETITLKPASTDYVYKTESASKDNGYVLSTYMKPGYWS
FT                   RTSSGWKPVSREGRNDVAYCEFVTKYAKSFIPGEQQMPAQLYQSPTGHELEIIPLSDIS
FT                   RFSENVKLKVLYKTSPLAGAIMELDSVSYLTSSRHTHAVEHKHPVHKAELTFVTNEDGI
FT                   VTVPSLHIGQWLAKVQNKKSFQDKSLCDETVDVATLSFSRN"
FT   CDS_pept        43189..44388
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF38"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W94"
FT                   /protein_id="CAD66186.1"
FT                   /translation="MNRIPVIIINGFLGAGKTTLMKNLLTQANRNHLAVSVIVNDMSDL
FT                   DVDGVLIANTEIVNIANNNFVSITSDSISSQSGIKTVDKAIKNMLRHYLPDVIFVETSG
FT                   GSHPLPLIKYLQTHERLQLKSLLSLVDIVMLNDDYNGGKALIPAFQENLFYGKRRIENL
FT                   LAEQIMFCSTLLLTKKDRLSFDIVTDVAKAIHPLNPYVNVIAVSWGNLKLAELLTLPDY
FT                   DFNRVGLLIRELEDTITVEEAKISAQNGEIISRVIKDDRPFHPQRLWETYHYFMGMGIY
FT                   RSKGFFWLPGRPDMALLWNQAAGSINLEFISYWNSGVLADPDNHLTHEERSVLQKKVNK
FT                   TMGRFGDRRCHLTIIGRSDEVHDFTSALINCFLSEEEIVWWQSGGVFADPWPVNISRLN
FT                   "
FT   CDS_pept        44843..45442
FT                   /transl_table=11
FT                   /gene="y1094"
FT                   /product="transposase Orf A, insertion element IS100"
FT                   /db_xref="GOA:Q83W93"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W93"
FT                   /protein_id="CAD66187.1"
FT                   /translation="MVRLTTKPKLYIEFTDNMRYDTLETCHRNAFRFFGGVPREVLYDN
FT                   MKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLCRPFRAQTKGKVERMVQYTRNSFY
FT                   IPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKHETIQARPCDRWLEEQQSMLALPP
FT                   EKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA"
FT   CDS_pept        45442..46221
FT                   /transl_table=11
FT                   /gene="y1093"
FT                   /product="transposase Orf B, insertion element IS100"
FT                   /db_xref="GOA:Q83W92"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W92"
FT                   /protein_id="CAD66188.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLATAMGYEAARAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   CDS_pept        complement(46272..46889)
FT                   /transl_table=11
FT                   /gene="pB171ORF51"
FT                   /product="ORF51 protein of pB171"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W91"
FT                   /protein_id="CAD66189.1"
FT                   /translation="MDTSLAHENARLRALLQTQQDTIRQMAEYNRLLSQRVATYASEIN
FT                   RLKALVAKLQRMQFGKSSEKLRAKTERQIQEAQERISALQEEMAETLGEQYDPVLPSSL
FT                   RQSSARKPLPALLPHETRVIRPEEECCPACGGDLSPLGCDVSEQLELISSAFKVIETQR
FT                   PKLACCRCDHIVQAPVPSKPIARSYAGEGLLAHVVTGNVNDG"
FT   CDS_pept        complement(46909..47256)
FT                   /transl_table=11
FT                   /gene="pB171ORF50"
FT                   /product="ORF50 protein of pB171"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W90"
FT                   /protein_id="CAD66190.1"
FT                   /translation="MISLPAGSRIWLVAGITDMRNGFNDLASKVQNVLKDDPFSGHLFI
FT                   FRGRRGDQIKVLWADSDGLCLFTKRLERGRFVWPVTRDGKVHLTPAQLSMLLEGINWKH
FT                   PKRTERAGIRI"
FT   CDS_pept        complement(47253..47690)
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF43"
FT                   /db_xref="GOA:Q83W89"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W89"
FT                   /protein_id="CAD66191.1"
FT                   /translation="MGTCYGTKTLSAEPRRSFSNEFKLQMVKLDLQPVASVARIARGHD
FT                   INDNLLFKWLRLWQNEGRISQRLPVTTSSGAGVELLPVEITPDEPKEPMATLPPLLSTP
FT                   SQSTASASSCKVEFRHGKMTLENPSPELLTVLIRELSGRGR"
FT   CDS_pept        complement(48402..49289)
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF44"
FT                   /db_xref="GOA:Q83W88"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W88"
FT                   /protein_id="CAD66192.1"
FT                   /translation="MQMRNFIDYSLLKNLDLVIKQKGFYRAARILGISQSAISQKIKKL
FT                   ENQCGVQLITRTSPPHLTDYGQKLAGLLYHVNIFEHDVLNLDANKSIVTIPIAVNSDTL
FT                   ATWLIPALCVFLKNPSIRLDIKVDDENKNLKRLLKGEVVGCISSQPQAIIGGLCDYVGS
FT                   LDYIFCATPEFYSRYFSQGVSKENLLKAPIVSFNHDTDMHHKFLQQYFGLVPGTLQSHI
FT                   VSSSEAYVTMLLQHLACCMIPKQQISFELASGKIINLSPEFEQKVKLYWHRYSPESITM
FT                   QALSSALINNNILI"
FT   CDS_pept        complement(49336..50832)
FT                   /transl_table=11
FT                   /product="putative lysil-tRNA synthetase LysU"
FT                   /function="involved in translation"
FT                   /note="ORF45"
FT                   /db_xref="GOA:Q83W87"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W87"
FT                   /protein_id="CAD66193.1"
FT                   /translation="MSTDTNDSTNELYVRKQKLRQLRARTPVVFPNDFRRQHNSVELSE
FT                   QYGLLTHEDLTKKDINVIMAGRIMSRRIMGKSIFMHIQDNKGRIQLYCSSDILPESTFS
FT                   DIKKLDTGDIIGIKGKLFKTKTNELSVNCYEISLLTKSLRPLPDKFHGLLDQELRYRQR
FT                   YVDLIVNHDTYRTFETRSRILTEIRRYMAEHDFMEVETPMMQSIPGGASARPFITHHNA
FT                   LDQDMFLRISPELYLKRLVVGGFERVFEINRNFRNEGISPRHNPEFTMMELYIAYADFH
FT                   DLINFTEDLFRTVAQNVLGTTLIEYGDELFDFGKPFNKLTMRESIIKYGNGITLTDIDD
FT                   IQSASLTARKLGITVEPSWGVGRLQSEIFEEVVEQHLIQPTFITEYPAEISPLARRNDK
FT                   NPLYTDRFEFFIGKREIGNGFSELNDAEDQAERFKEQVKAKEAGDEEAMYYDEDYVTAL
FT                   EYGMPPTAGLGIGIDRMIMLFTNCHTIRDVIMFPAMRTSK"
FT   CDS_pept        complement(51126..51836)
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF46"
FT                   /db_xref="GOA:Q83W86"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W86"
FT                   /protein_id="CAD66194.1"
FT                   /translation="MTVFSFIKEVLSPHIRLLYSPQELGFNDAGLIVLNHFGYDNNIYY
FT                   SVTLTRKEITSFQNTSENTHYFAYSKTIKKTIDRIFKITGEKITIGNITPSINGKVSVT
FT                   LILSLLEMKLIDFIADDNTDVRVRLTVLNMLNNNTTTIRELAASVYLQEDYLKRIFRRY
FT                   TGTGLYQFYNWIKLLKAISKIQNNDKIKKIAIELGYSSSSSFNYSFKKEFSIGPRDYIK
FT                   EYLHNKISCMAVHE"
FT   CDS_pept        complement(52040..54166)
FT                   /transl_table=11
FT                   /product="putative cadaverin decarboxylase"
FT                   /function="involved in metabolism"
FT                   /note="ORF47"
FT                   /db_xref="GOA:Q83W85"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W85"
FT                   /protein_id="CAD66195.1"
FT                   /translation="MNTILIGSKSFDNKYVAEIISHLHTKNFGTELAGCSEKIETIIRN
FT                   NARIAAVLLDLDDSNDILDKIRMLNEHLPVFLLKTDDVAIKKFCFDSFDGNVHLIDCCL
FT                   YSVDEIVNKIQKIINDYIDAILPPLTKALFNYVKEGKYTFCTPGHMGGTAYQKSPAGSL
FT                   FYDFFGENTMKSDISVSVGELGSLLDHSGPHSEAEKYIAETFNADRSYIVTNGTSTANK
FT                   IVGQFSVPAGCTALIDRNCHKSLTHMLMMSDIIPIYLKPTRNAYGILGGIPRTEFSSDS
FT                   IKQKMAVTPGATWPVHAVITNSTYDGLFYNTDWIKEHLDVKSIHFDSAWVPYTNFSPIY
FT                   SGKTGMGGKRIEGKVIYETQSTHKLLAAFSQASMIHVKGDINEETFNEAYMMQTSTSPH
FT                   YGIVASTEMAAAMMKGNPGKRLIQESMERALAFRKEIQARFENSDTWFFKVWQPENINE
FT                   VDCWPLDKNDQWHGFKDIDQEHMYLDPIKVTLLTPGLDKYGKIEEQGIPAALVSKFLDD
FT                   RGIIVEKTGPYNILFLFSIGIDDTKALSLLHGLYEFKERYDRNELVKDILPGIWAESPA
FT                   FYNNMRIQELAQGIHNLIRKHNLPELMFRAFDVLPEMVMKPQQAFQAELRGETEECFIE
FT                   DLVGKINANMILPYPPGVPLVLPGEMITESNRPVLEFLLMLCEIGNHYPGFETDIHGLY
FT                   RKADNRYTAKVIKK"
FT   CDS_pept        complement(54197..55561)
FT                   /transl_table=11
FT                   /product="putative lysin/cadaverin transporter"
FT                   /function="involved in the transport of small molecules"
FT                   /note="ORF48"
FT                   /db_xref="GOA:Q83W84"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W84"
FT                   /protein_id="CAD66196.1"
FT                   /translation="MSLRKLIINKSLAKEDKIMSGPKKIGLITCIAVVAGNMMGSGIAL
FT                   LPASLAKIGSVAIWGWIIAAIGALSLAYVFARLATNNPQTGGPIAYAGEVAPIFGHQTS
FT                   ILYYHANWIGNLAIAITAVAYLSVFFPVLNNPVPAAITSIAMVWLFTFVNLLGGAWVSR
FT                   LTSIGLVLVLIPVVGTALFGWGSFDIEVYRQNWMAQPDGNVHQAVINSVLLCLWAFVGV
FT                   ESAAVSSDLVHNPSRTVPLATLGGTALAGIVYIAASQVIAGMFPNEVVANSGAPFALSA
FT                   SRIVGDWAAPFVSAFTAIACLTSLGSWMMLVGQAGRRAAMDGNFPAVFGETDNNGVPKK
FT                   GLLIASTMMSILMVLLTILSASGSNAADLFTQLTSIAVLLTMFPYFYSAIDLIRFESAT
FT                   SKSILSLIASAFAMLFCFAALAGAEHYEITATIIISLLIFAFYARKLGGIQHKNI"
FT   CDS_pept        55894..56256
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF49"
FT                   /db_xref="GOA:Q83W83"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W83"
FT                   /protein_id="CAD66197.1"
FT                   /translation="MVELASQPGACVAQIARENGLNDNVIFKWLRLWRSEGRVSRRLLV
FT                   TTSSDSGVELLPVEITPDEQKVPMTAIAPSLSTSTQTTVCASSCKVEFRHGKMTLENPS
FT                   PELLTVLLRELTGRGG"
FT   CDS_pept        <56557..>56739
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF50"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W82"
FT                   /protein_id="CAD66198.1"
FT                   /translation="NQSFHLFLVHNQMPLHHYPHCYHSRKLPPDTGVHDNSHRHSFHRQ
FT                   IMICRILNMIHHNYT"
FT   CDS_pept        57070..57942
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /function="putative histone"
FT                   /note="ORF51"
FT                   /db_xref="GOA:Q83W81"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W81"
FT                   /protein_id="CAD66199.1"
FT                   /translation="MNPSDAIEAIEKPLSSLPYSLSRHILEHLRKLTSHEPVIGIMGKS
FT                   GAGKSSLCNALFQGEVTPVSDVHAGTREVQRFRLSGHGHSMVITDLPGVGESRDRDAEY
FT                   EALYRDILPELDLVLWLIKADDRALSVDEYFWRHILQRGHQQVLFVVTQADKTEPCHEW
FT                   DVAGIQPSPAQAQNIREKTEAVFRLFRPVHPVVAVSARTGWELDTLVSALMTALPDHAA
FT                   SPLMTRLQDELRTESVRAQAREQFTGAVDRIFDTAESVCVASVARTVLRAVRDTVGSVA
FT                   RAVWNWIFF"
FT   CDS_pept        58270..61398
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /function="putative adhesin"
FT                   /note="ORF52"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR030930"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W80"
FT                   /protein_id="CAD66200.1"
FT                   /translation="MLMKRHLNTCYRLVWNHITGAFVVASELARARGKRGGVAVALSLA
FT                   AVTSLPVLAADIVVHPGETVNGGTLVNHDNQFVSGTADGVTVSTGLELGPDSDENTGGQ
FT                   WIKAGGTGRNTTVTANGRQIVQAGGTASDTVIRDGGGQSLNGLAVNTTLDNRGEQWVHG
FT                   GGKAAGTIINQDGYQTIKHGGLATGTIVNTGAEGGPESENVSTGQMVGGTAESTTINNN
FT                   GRQVIWSSGVSRDTLIYTGGDQTVHGEAHNTRLEGGNQYVHKYGLALNTVINEGGWQVV
FT                   KAGGTAGNTTINQNGELKVHAGGEASDVTQNTGGALVTSTAATVTGTNRLGAFSVVEGK
FT                   ADNVVLENGGRLDVLSGHTATNTRVDDGGTLDVRNGGTATTVSMGNGGVLLADSGAAVS
FT                   GTRSDGTAFRIGGGQADALMLEKGSSFTLNAGDTATDTTVNGGLFTARGGSLAGTTTLN
FT                   NGAILTLSGKTVNNDTLTIREGDALLQGGSLTGNGSVEKSGSGTLTVSNTTLTQKAVNL
FT                   NEGTLTLNDSTVTTDVIAQRGTALKLTGSTVLNGAIDPTNVTLASGATWNIPDNATVQS
FT                   VVDDLSHAGQIHFTSTRTGKFVPATLKVKNLNGQNGTISLRVRPDMAQNNADRLVIDGG
FT                   RATGKTILNLVNAGNSASGLATSGKGIQVVEAINGATTEEGAFVQGNRLQAGAFNYSLN
FT                   RDSDESWYLRSENAYRAEVPLYASMLTQAMDYDRILAGSRSHQTGVNVKNNSVRLSIQG
FT                   GHLGHDNNGGIARGATPESSGSYGFVRLEGDLLRTEVAGMSVTAGVYGAAGHSSVDVKD
FT                   DDGSRAGTVRDDAGSLGGYLNLTHTSSGLWADIVAQGTRHSMKASSDNNDFRARGWGWL
FT                   GSLETGLPFSITDNLMLEPQLQYTWQGLSLDDGQDNAGYVKFGHGSAQHVRAGFRLGSH
FT                   SDMTFGEGTSSRDTLRDSAKHSVRELPVNWWVQPSVIRTFSSRGDMSMGTAAAGSNMTF
FT                   SPSQNGTSLDLQAGLEARVRENITLGVQAGYAHSVSGSSAEGYNGQATLNVTF"
FT   CDS_pept        61725..62543
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF53"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W79"
FT                   /protein_id="CAD66201.1"
FT                   /translation="MRLASRFGYANQVRRDRPLTHEELMRHVPSIFGEDRHTSRSEHYA
FT                   YIPTITVLENLQQEGFQPFFACQTRVRDPGRRGYTKHMLRLRRNGEINGQHVPEIILLN
FT                   SHDGTSSYQMLPGYFRFVCQNGCVCGQSLGEVHVPHRGNVVDRVIEGAHEVVGVFDRIE
FT                   EKRDAMQSLVLPPPARQALAQAALTYRYGDEHQPVTTADILTPRRREDYGKDLWSAYQT
FT                   IQENMLKGGISGRSAKGKRIHTRAIHSIDTDIKLNRALWVMAETLLESMR"
FT   CDS_pept        62635..63120
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF54"
FT                   /db_xref="InterPro:IPR004914"
FT                   /db_xref="InterPro:IPR042297"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W78"
FT                   /protein_id="CAD66202.1"
FT                   /translation="MTTSSHNSTTPSVSVTTASGNNQSQLVATPVPDEQRISFWPQHFG
FT                   LIPQWVTLEPRVFGWMDRLCEDYCGGIWNLYTLNNGGAFMAPEPDGDDDETWVLFNAMN
FT                   GNRAEMSPEAAGIAACLMTYSHHACRTECYVMTVHYYRLRDYALQHPECSAIMRIID"
FT   CDS_pept        63136..63612
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF55"
FT                   /db_xref="GOA:Q83W77"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W77"
FT                   /protein_id="CAD66203.1"
FT                   /translation="MQQISFLPGEMTTRERSLIQRALKALDRHLHEPGVAFTSTRAARE
FT                   WLILNMAGLEREEFRVLYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVV
FT                   LAHNHPSGEVTPSKADRLITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL"
FT   CDS_pept        63681..63902
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF56"
FT                   /db_xref="InterPro:IPR009329"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W76"
FT                   /protein_id="CAD66204.1"
FT                   /translation="MKIITRGEAMRIHRQHPASRLFPFCTGKYRWHGSTEAYTGREVQD
FT                   IPGVLAVFAERRKDSFGPYVRLMSVTLN"
FT   CDS_pept        63902..64015
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF57"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W75"
FT                   /protein_id="CAD66205.1"
FT                   /translation="MFRHPENEYDWLSSDAAVDEALLINEYTFTEGGLRAG"
FT   CDS_pept        64065..64433
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF58"
FT                   /db_xref="GOA:Q83W74"
FT                   /db_xref="InterPro:IPR009320"
FT                   /db_xref="InterPro:IPR038025"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W74"
FT                   /protein_id="CAD66206.1"
FT                   /translation="MSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLA
FT                   DRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTL
FT                   GSGGYVYLAVYPTPETKK"
FT   CDS_pept        64523..64900
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF59"
FT                   /db_xref="InterPro:IPR009610"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W73"
FT                   /protein_id="CAD66207.1"
FT                   /translation="MKTLPDTHVREASRCLSPVEIWQTLLTRLLDQHYGLTLNDTPFAD
FT                   ERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGFSPCTRSQLINSIDILRARRATGLM
FT                   TRDNYRTVNNITRGKHPEAKQ"
FT   CDS_pept        <64879..65385
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF60"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W72"
FT                   /protein_id="CAD66208.1"
FT                   /translation="ASGGETMKLALTPEADSINVQALNMGRIVVDVDGVTLAELINVVC
FT                   DNGHSLRIVDESDRASTDCMPPFAALTGIRCSTAHITETDNAWLYSLSHQTNDDGESEW
FT                   IHFTGSGYLLRTDTWPYPVLRLKRLGLSRTFRRLVVTLIRRYGVSLIHLDASARCLPGL
FT                   PTFNW"
FT   CDS_pept        65352..65594
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF61"
FT                   /db_xref="InterPro:IPR009301"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W71"
FT                   /protein_id="CAD66209.1"
FT                   /translation="MPAGFTHFQLVTRNNMKSLTTETALDILIAWLQDNIDCESGIIFD
FT                   NDEDKTDSAALLPCIEQAREDIRTLHQLQFLQQNW"
FT   CDS_pept        65709..66533
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF62"
FT                   /db_xref="InterPro:IPR031339"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W70"
FT                   /protein_id="CAD66210.1"
FT                   /translation="MVNGHTDVIGSTSIRHILAVRQSTLLQIDTLIRQLAEISAMTVSI
FT                   GGKTALDWAMKQDFRCGFWLMEKPEIAMKAITRNLDRELWRDLMQRSGMLSLMDAQARE
FT                   TWYRSLEYDNVPEISEANILNTFKQLHQNKDEVFERGVINVFRGLNWNYKTNLPCKFGS
FT                   KIIVNNLVRWDRWGFHIVTGQQADRVADLERMLHLFSGWPIPDNRENIIIRLDDHIQSA
FT                   QGQECYEYEDEMFSIRYFKKGSAHITFRKPELIDRLNDIIAKYYPEIIPYNI"
FT   CDS_pept        complement(66626..67981)
FT                   /transl_table=11
FT                   /product="putative phage integrase"
FT                   /function="involved in integration, excision of DNA"
FT                   /note="ORF63"
FT                   /db_xref="GOA:Q83W69"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W69"
FT                   /protein_id="CAD66211.1"
FT                   /translation="MCTPLCTQKAEDMTFTITQDRQLASLTVTKEEKEILFAVKSKAGG
FT                   GLFIRVRYGSDNKSWIYRYRIAQKPAKLTLGSYPAMGLAQARKAHADAIELVRKGIDPR
FT                   HIRKNEKQKNEQMIIYSELWKDWIEFRKTSKPISTRTLADYEGTYHRHLEKALGNLRID
FT                   ELTKSVIFEHLSNVRKTSSEAVRKGLIILNMTLDHANLQGMLEHNPARLLKPAMFGASM
FT                   NKPRERWLPENELRMLWKALDDATVGGGSIASGGYGISSSVVLSHSVANALRLIIFTGV
FT                   RRSEAAQMRWDQINGERWTIPATKNGKSHIVTLHPYMLSLIKTQREFTEGAYVFGSTSK
FT                   PDFPITNDALTRALERVRSKYLAELTPFSPHDLRRSVATGCAEYLDAPERLIELLLNHV
FT                   PKDRLIRTYQVGQQAEKLKNLFIEWGNFIMNNVITVQQNAPDNVIHIKFGNR"
FT   misc_feature    68109..68158
FT                   /note="48-bp direct repeat at the right border of
FT                   pathogenicity island III(536)"
FT   misc_RNA        68111..68158
FT                   /note="truncated tRNA gene thrW"
FT   CDS_pept        complement(68361..68753)
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /note="ORF64"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W68"
FT                   /protein_id="CAD66212.1"
FT                   /translation="MSRSLRTNLILIIGSFYHYMITKHTMYNYIHYYCDYNLLLCHSRA
FT                   ISLKVLFNCVSRAIFSSRFTSIRSIPPEIPLLASSSFAGASAKVTSGYTPSANSFSLPA
FT                   TRYLRRQYSPPPGFTRRYRPPPSANL"
FT   CDS_pept        complement(69084..69608)
FT                   /transl_table=11
FT                   /product="putative MarR-family transcriptional regulator"
FT                   /function="involved in regulation"
FT                   /note="ORF65"
FT                   /db_xref="GOA:Q83W67"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W67"
FT                   /protein_id="CAD66213.1"
FT                   /translation="MSFLLPCGGIMNNIDLLKTITNYKKIKNPAYPAQESLLIHLYIRV
FT                   NDKIQSIIENELSEYRINTSTFMVLVSLYMSDDYCQSPSDIYKELQFSKTNITHIIDKL
FT                   EKKNIAKRINNKNDRRSKSICLTPDGVTLAQKLINTQNVMLKKIWSGLSDDEMKTFELA
FT                   NKKLLSNLNVN"
FT   CDS_pept        complement(69734..73864)
FT                   /transl_table=11
FT                   /product="putative hemoglobin protease"
FT                   /note="ORF66"
FT                   /db_xref="GOA:Q83W66"
FT                   /db_xref="InterPro:IPR000710"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030396"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W66"
FT                   /protein_id="CAD66214.1"
FT                   /translation="MNKIYALKYCYITNTVKVVSELARRVCKGSTRRGKRLSVLTSLAL
FT                   SALLPTVAGASTVGGNNPYQTYRDFAENKGQFQAGATNIPIFNNKGELVGHLDKAPMVD
FT                   FSSVNVSSNPGVATLINPQYIASVKHNKGYQSVSFGDGQNSYHIVDRNEHSSSDLHTPR
FT                   LDKLVTEVAPATVTSSSTADILTPSKYSAFYRAGSGSQYIQDSQGKRHWVTGGYGYLTG
FT                   GILPTSFFYHGSDGIQLYMGGNIHDHSILPSFGEAGDSGSPLFGWNTAKGQWELVGVYS
FT                   GVGGGTNLIYSLIPQSFLSQIYSEDNDAPVFFNASSGAPLQWKFDSSTGTGSLKQGSDE
FT                   YAMHGQKGSDLNAGKNLTFLGHNGQIDLENSVTQGAGSLTFTDDYTVTTSNGSTWTGAG
FT                   IIVDKDASVNWQVNGVKGDNLHKIGEGTLVVQGTGVNEGGLKVGDGTVVLNQQADSSGH
FT                   VQAFSSVNIASGRPTVVLADNQQVNPDNISWGYRGGVLDVNGNDLTFHKLNAADYGATL
FT                   GNSSDKTANITLDYQTHPADVKVNEWSSSNRGTVGSLYIYNNPYTHTVDYFILKTSSYG
FT                   WFPTGQVSNEHWEYVGHDQNSAQALLANRINNKGYLYHGKLLGNINFSNKATPGTTGAL
FT                   VMDGSANMSGTFTQENGRLTIQGHPVIHASTSQSIANTVSSLGDNSVLTQPTSFTQDDW
FT                   ENRTFSFGSLVLKDTDFGLGRNATLNTTIQADNSSVTLGDSRVFIDKKDGQGTAFTLEE
FT                   GTSVATKDADKSVFNGTVNLDNQSVLNINDIFNGGIQANNSTVNISSDSAILGNSTLTS
FT                   TALNLNKGANALASQSFVSDGPVNISDATLSLNSRPDEVSHTLLPVYDYAGSWNLKGDD
FT                   ARLNVGPYSMLSGNINVQDKGTVTLGGEGELSPDLTLQNQMLYSLFNGYRNTWSGSLNA
FT                   PDATVSMTDTQWSMNGNSTAGNMKLNRTIVGFNGGTSSFTTLTTDNLDAVQSAFVMRTD
FT                   LNKADKLVINKSATGHDNSIWVNFLKKPSDKDTLDIPLVSAPEATADNLFRASTRVVGF
FT                   SDVTPTLSVRKEDGKKEWVLDGYQVARNDGQGKAAATFMHISYNNFITEVNNLNKRMGD
FT                   LRDINGEAGTWVRLLNGSGSADGGFTDHYTLLQMGADRKHELGSMDLFTGVMATYTDTD
FT                   ASAGLYSGKTKSWGGGFYASGLFRSGAYFDLIAKYIHNENKYDLNFAGAGKQNFRSHSL
FT                   YAGAEVGYRYHLTDTTFVEPQAELVWGRLQGQTFNWNDSGMDVSMRRNSVNPLVGRTGV
FT                   VSGKTFSGKDWSLTARAGLHYEFDLTDSADVHLKDAAGEHQINGRKDGRMLYGVGLNAR
FT                   FGDNTRLGLEVERSAFGKYNTDDAINANIRYSF"
FT   CDS_pept        74457..74672
FT                   /transl_table=11
FT                   /product="truncated InsA protein"
FT                   /note="ORF67"
FT                   /db_xref="GOA:Q83W65"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W65"
FT                   /protein_id="CAD66215.1"
FT                   /translation="MATVTVHRPRCNSDKVYRHGRSCSQHERFRCRSCKRVFQLTYSYE
FT                   ARKPGFKELIVEMAHNGTGAVISPEH"
FT   CDS_pept        <74961..>75140
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /product="truncated InsB protein"
FT                   /note="ORF68"
FT                   /db_xref="GOA:Q83W64"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q83W64"
FT                   /protein_id="CAD66216.1"
FT                   /translation="YAREVPKEKYLTGKIFTQRIERNNLTLRTRIKRLVSKTICFSRSV
FT                   EIHEKVIGSFIEKH"
XX
SQ   Sequence 75812 BP; 19945 A; 17522 C; 18127 G; 20218 T; 0 other;
     agggccgata tagctcagtt ggtagagcag cgcattcgta atgcgaaggt cgtaggttcg        60
     actcctatta tcggcaccat ttaaatcaat aagttacctc acatttaagt aaactacgtt       120
     ctcctcttgt gccgtatttg tgccattgcg acttataatc gcatcgattt tgctcgcgtg       180
     ctcggtgaga tgcccggctg aaaggtgggc gtatctttga accatttcga gagtttccca       240
     tcctcccatc tctttaagtg caagaagaga gacaccggac tgaaccagcc agcttgccca       300
     tgtatgcctc aggtcatgga agcggaagtt gctaatgcct gcccgcttta acgctccctt       360
     ccatgccttg ttgctgtcgg ttctcatctt ccttaccgct gctgtttttg ttccgtcgct       420
     tcggtaggca ggtttggtgt ggacaaacac ccatctctta tggagaccct gctgttttct       480
     taatatctgg catgcggttt cgttaagagg aactccgatc gcattgccag cttttgtttc       540
     atcagggtgc atccatgcca ttttcttatc cagatcgacc tgtgaccact caaggtctgt       600
     aacgttggaa cggcgaaggc ctgtcgtgat tgcaaacatg accacaggga agaaatgagg       660
     agcaatttct gcaaacaggc gcttcgattc ctcctctgta agccatctga ttcgtccatt       720
     cttaacgcgt ggtgttgata ttttgggcgt cctgtcaagc catccccatt caacagccat       780
     attgagaata gcgcgaagta ttgccagatg ccgcgtcttc gttcctttgc ttgccagctt       840
     tggtttatac tccggcactg gcttgccaag ccgcaaacac ctgtcccggc tcatctccca       900
     gttcaggcga tggcggcggt tttccatccc gtctaccgcc tccattattt tttctgttgt       960
     tatgtcagag agaatggttt ctctgaagtg caacatccag aacgatataa tgctcttgtc      1020
     atcatcaatg gacttcttat ccgatttctc acgcagccac cgtatgcagg cttccttgaa      1080
     tagctttttc ggtgattccc cgagattttt tactctccac gcttctgctt tcagacgatc      1140
     gtgaagttct tgcgcttgcc ttttgtccga tgtttcaaga gagcgtctaa ctcttgatcc      1200
     atctggcgcg acgaaatcac agtgccacgt gccaccgcgt agtttgattg acatgcttta      1260
     acctcctgca catcaaccgc attcaccgcg ctattgtgtc ttacagactt aagcgccgca      1320
     atgcagtctg acttgcaaat gcgatatggg cttttaggtt tatctggatt tatctttgcg      1380
     gcctgaagtc gtccacttcg tatccactgc gtgatagtgc ctttgtctac cttaagatac      1440
     gacgctgcct cttcacgagt gaagatttct tcttccactt ggaatctcca tttattgagt      1500
     tggtattatt gcggtaggtc tggatatctt gagaaatgaa caggcctcat cgagtgtgag      1560
     gctgtggtta gtccttgcgt aactcgctaa ttcttctgta agtctctggc gctttgtttc      1620
     cgtgtatctt catttcagac ttcaacagag caacgagaga atcccattcg ttgaggatgc      1680
     ctttgaatgc cggaacgcgc tttgcaacct tgtcgaatga atctctgatt tctggaatct      1740
     gctcaacaag tgcaacgcat cgtcggaaat cggctgcgtc atggggagcg ccgaagctat      1800
     gaccatagat attctttttc agtccacatg cgattgaggc aagagttgcg ctactgatgc      1860
     cgacatcgcc agtcgattgc catttcaaaa ccttcatagc caaatctgac atttcttgtc      1920
     tccataaaac aaaactcgcc gtagcgagtt cagataaaag acatccccgc gagttcgagg      1980
     attgttattc attgccgata ttcaccttta tcgcgaacac ctttaccggt ttatcgccga      2040
     agtgcggatg tgtgattgtc ttgatttcat atccgtcata cggaacatca attctacggc      2100
     tggaatcgtc gcgcttcgga tattgtcacg aacggtgcaa tagtgatcca cacccaacgc      2160
     ctgaaatcag atccaggggg taatctgctc tcctgattca ggagagttta tggtcacttt      2220
     tgagacagtt atggaaatta aaatcctgca caagcaggga atgagtagcc gggcgattgc      2280
     cagagaactg gggatctccc gcaatacggt taaacgttat ttgcaggcaa aatctgagcc      2340
     gccaaaatat acgccgcgac ctgctgttgc ttcactcctg gatgaatacc gggattatat      2400
     tcgtcaacgc atcgccgatg ctcatcctta caaaatcccg gcaacggtaa tcgctcgcga      2460
     gatcagagac cagggatatc gtggcggaat gaccattctc agggcattca ttcgttctct      2520
     ctcggttcct caggagcagg agcctgccgt tcggttcgaa actgaacccg gacgacagat      2580
     gcaggttgac tggggcacta tgcgtaatgg tcgctcaccg cttcacgtgt tcgttgctgt      2640
     tctcggatac agccgaatgc tgtacatcga attcactgac aatatgcgtt atgacacgct      2700
     ggagacctgc catcgtaatg cgttccgctt ctttggtggt gtgccgcgcg aagtgttgta      2760
     tgacaatatg aaaactgtgg ttctgcaacg tgacgcatat cagaccggtc agcaccggtt      2820
     ccatccttcg ctgtggcagt tcggcaagga gatgggcttc tctccccgac tgtgtcgccc      2880
     cttcagggca cagactaaag gtaaggtgga acggatggtg cagtacaccc gtaacagttt      2940
     ttacatccca ctaatgactc gcctgcgccc gatggggatc actgtcgatg ttgaaacagc      3000
     caaccgccac ggtctgcgct ggctgcacga tgtcgctaac caacgaaagc atgaaacaat      3060
     ccaggcccgt ccctgcgatc gctggctcga agagcagcag tccatgctgg cactgcctcc      3120
     ggagaaaaaa gagtatgacg tgcatcctag tgaaaatctg gtgaacttcg acaaacaccc      3180
     cctgcatcat ccactctcca tctacgactc attctgcaga ggagtggcgt gatgatggaa      3240
     ctgcaacatc aacgactgat ggcgctcgcc gggcagttgc aactggaaag ccttataagc      3300
     gcagcgcctg cgctgtcaca acaggcagta gaccaggaat ggagttatat ggacttcctg      3360
     gagcatctgc ttcatgaaga aaaactggca cgtcatcaac gtaaacaggc gatgtatacc      3420
     cgaatggcag ccttcccggc ggtgaaaacg ttcgaagagt atgacttcac attcgccacc      3480
     ggagcaccgc agaagcaact ccagtcgtta cgctcactca gcttcataga acgtaatgaa      3540
     aatatcgtat tactggggcc atcaggtgtg gggaaaaccc atctggcaat agcgatgggc      3600
     tatgaagcag tccgtgcagg tatcaaagtt cgcttcacaa cagcagcaga tctgttactt      3660
     cagttatcta cggcacaacg tcagggccgt tataaaacga cgcttcagcg tggagtaatg      3720
     gccccccgcc tgctcatcat tgatgaaata ggctatctgc cgttcagtca ggaagaagca      3780
     aagctgttct tccaggtcat cgctaaacgt tacgaaaaga gcgcaatgat cctgacatcc      3840
     aatctgccgt tcgggcagtg ggatcaaacg ttcgccggtg atgcagcact gacctcagcg      3900
     atgctggacc gtatcttaca ccactcacat gtcgttcaaa tcaaaggaga aagctatcga      3960
     ctcagacaga aacgaaaggc cggggttata gcagaagcta atcctgagta aaacggtgga      4020
     tcaatattgg gccgttggtg gagatataag tggatcactt ttcatccgtc gttgacagtt      4080
     gcaatctgtt gtgtggtgag ctgggtcaga atgtgttcaa accaggttcg ggaggacaac      4140
     cccttactct ggatataccc gagtagacgt tctgcaagcc tatgttgttg ttcaggatat      4200
     ccggcgatgt cgaatatctc attgagcatt tcaggtgaaa gtacattctg tggggcggaa      4260
     aaagcgaaat aatagagcca gtatgcttgg ctgcccagac gtttgccagc agtcagcagg      4320
     gcactatcct gttcgggagt cggtacaaag agtttgatgg gcgagtcagt tttccagccg      4380
     gtgatacccg ggacccagcg agcaagggca tgcaccgcat gggcttcggc agggaaataa      4440
     cgggcaaggt gcgactttag gctctccgcc atctctgcct gctctaactc acttacatgc      4500
     ccgtcaccgg cggctacgac cgctcgttct gacagatatt cttctaccca gtcataaaga      4560
     cccgcatttg ttgtgcgcag cagttgaagg aagcacagat ccgggaaata cacgtaatcc      4620
     cgcatgcccg ggtataggaa ggtcagggca ttcagtacca tctgaacctc cctgggggtt      4680
     tttaatgctg ccccgtagac gtcagccact tgtgtcaatt gctctagtac aatacggtct      4740
     ggagcatgcc cgtttacttt tctgtataac gcggcagcgg catccctaaa ttttctgcgc      4800
     aagacaaagg tttctgggcg cggtaaacag aatgatatct gaacaatttt ctgcaggtat      4860
     aggttgccgt cgggtacccc cagccctagg ctgatggcct gggataggat ggctttgtca      4920
     taacagagaa ggtagcgaaa gcgaggaaag tcacctacag atttaactag ccttatcacc      4980
     tcaactgcct gtgctggctc gagacgatcc agatcatcaa gcagtacaat aaagctaaga      5040
     tccagttcat ctattttctt cgcaatttcg gtccgcatct ctgctgtggt tttctccttt      5100
     tccttcagcc aacgagtttc tgacagggct ttcaacgcgc cactggcatc aggtacgccg      5160
     ggaataacgg cggcggctga ggcgacggtt gcgagattgc gggcagttgc ccgggtgtag      5220
     tctatcatcg tcttggccgt ccgtgtcagg gattttcgtc gtctgagagc tgccctttcc      5280
     tcaggcgcta gtcgctgttc ctcttcagca gcaatgatgt tggcgacagg aagcagtaac      5340
     gatgccacca gacttgtgtt gctcccgtcg agccaggggg atattgtcaa tacaaaagta      5400
     cattcttcta tttgttcgac gagagcattg cgcagcaggt taaggagact cgttttccct      5460
     gatccccatg ggccttcgat accgatcact gcgctaccct cgcggccaat acccttaacg      5520
     gcaacagcta actgggtagc tatgtggatg aaaccatact ggtcttcatc ggcggaacag      5580
     attgcgcgat ctggatgttg gccctgaagg ttgtctgcgt gtggttgatt catattcaca      5640
     aatctccgta aatgcagccg atgctgcgca gtgtctgtga cgtggtactg tttccacgca      5700
     aggccagcaa aagactgacc tgcggttagt tttcgtttag gtaagtgctt ttgcggatgg      5760
     ctcagtaacg tatcacaata aataatgcca tagtgtatga ggggaaagta catacatctt      5820
     gttccctctt cgaaagtgac agcccgggat aaagaggtta caacgataag ggtctcccgc      5880
     cgaaatgatg aatgcttatg gctggggaaa gctaagagta tgctggacgc ttagaaaact      5940
     gctaaaactg tgaaccttga taagtttgtc cccgcgccag attacttcct ttcgaggttg      6000
     cagtattatc ggtgaaattg tggtacccga gagtagctca ttcgttcaag cgcatcgcca      6060
     atatttttta gcaggtgcca tcgatcgatc acctgtctgg cctgaggtgc accttcacgt      6120
     gctgctgtcg catagactcc actgcgatca cgcgagacaa cctgtatttc cggatatttt      6180
     ctgaaccagg tcgccagcgt acgctgatca cggccgggaa gcaggacgag gggacggtga      6240
     gtatcaagat tgacgattaa cgtactgtaa tggtggcccc gatgccacgc ccactcatca      6300
     ataccgacat gaggcgcgcc tgactgtttc gtctccgggg tattgataac cctgcgaaga      6360
     agagtatcag cactgcaacg gagacccact gccgttgcag cccgtttccc ggcctcacct      6420
     ccggctatta atcccagttg acgttgtaaa ttttgtaacg cctgtgaaga ctgctggtgt      6480
     gaaccggcga agggagcaag cgactcggca aaaaatttac gtgaacaagc cgggttacgg      6540
     cagtaccagt ggcggacgga aaatacaagc catagcgtat gcccttagca gggtagatgc      6600
     tgtatccggc gccgacgaca actatgaaca gagtcgctac gcttaaagca ttcaggacat      6660
     tgtgcagttt ttcgttttcc gtggagatgg agggttatac cgtcagagct aataatttgt      6720
     cgactgcatc gccatccgca aggtaactgt agaagtgtct taagagagtg cattgagttg      6780
     cccaaaactt aaaacagctt agatctttgt tcaccagaaa gtttcatcca ttttcttcca      6840
     gtcaggttgc ggaagaacca cttttgcacc gttcgtgata ttaagcttta aaacggcaag      6900
     gtcaataccc agttgttccg ccactattgt gataacagcc ttcgggggga gcttttctgt      6960
     acgcagtgtg cgaccgagag cacggacaag tgcaagctga atggcaaaac caagacggtt      7020
     atgagaccgc cgctgagctc tggcaaatgc aatattttcg caggagagtg ctcatcgggg      7080
     aattaaagtt caggtaatcc aaaaagcgta tcgtgcgagt ttgtcacgca agaaatcaca      7140
     gatttataga ttcaattttc ttcaactgta ggaccttacg gaaaacaagt gatttcaagg      7200
     tgaaaaggct taacgtgagt tatcgcagaa atggttacgg aacatcctgt attgtcaaac      7260
     atgcattaaa tgattatcat tatcaattag tgtgtgcaac agatggttaa gaatagaact      7320
     ttcaggagat acaatgcagt cagtcagtaa atcaatctac cgagggaagt tgcttggcag      7380
     tttacctgct gtgggcgaga ttcataaaga aatcgcagta tcagaagaaa ccgtaacatg      7440
     gatctctctg caacgagaga ttatagcgaa tattttgctg ggaaaagatc ctcgcttgct      7500
     tgtgattgtt ggtccatgct caatccatga cgttcaggct gccgttgaat atgcgaaacg      7560
     attgtccgta ttacagaata agtacttatc gcaaatgtac attgtaatgc gcacttattt      7620
     tgagaaacct cgaactcgta aaggctggaa aggaataatg cacgagcctg atctaaatgg      7680
     aagctataat gttgagaaag ggatacgata tgctcgccag tgtttgtcct caatcacaac      7740
     aatgcgtgtc gcaaccgcta cagaattcct cgatcctttc cttactccct atattgctga      7800
     tttaatatgt tggggggctg ttggtgccag aactactgaa tcacaaacgc atcgtcaact      7860
     tgcatctggt ttacattgtc ctgttggatt taaaaacagc actgatggaa atattaactt      7920
     agctattgat gctattcttg cagcccgtga acaacatgtt gtatatatga catctttaac      7980
     aaaatgtata tctaccctat taaccgatgg caatccacat ggacatctca tattacgtgg      8040
     tggtagagag ccgaactatg gtttgtcgga tataacgaag gcagtgaaat taatgcatga      8100
     tgaaggtatc aatcatcgtc tgataattga ctgtagccat ggtaatagtg gtaaagtggc      8160
     tgaacggcaa atctctgttg ctcgtgaagt cattgataat cggaaaaaga tgccgggata      8220
     tgtagctgga attatgctgg aaagcttttt acaaggtgga aaacaatcag acagccttcc      8280
     gcgagagtat ggtcagtctg ttactgatga gtgtctttca tggcaacaga cagaacaatt      8340
     attatcaact ctggcagcac aactttaatt tcaactattc agtatcattt tttaagggaa      8400
     aaatgaaatt atttatctta atacacccaa tctgggcatc aaagaaacag atgttttatc      8460
     tgtacagttc attgttggaa gggaaataaa atatgacatg aatggcagaa gtgttatcac      8520
     tctgacatta atatttttat taggagttgc agtatttcta atataccatc tccaatggat      8580
     gtatcttcca gggtattatc tgtggggcct atgtgtatgt atattgtcaa accagttagc      8640
     tcttatgctt cattccctag cccttcttgg caaatgatac tgtacttgcg taggtgtcat      8700
     ctgtgacatg gttgcggtgc tattttgtct ctgttggctt aaaaagagta attaagacta      8760
     tgataaaaag ttaatttcca aagaacacgg tagggcgcta atcaataatc ggatgcatgc      8820
     taaatcatat tttataatat gtctgtggag atgatgctaa agtcatcaat agttcttgag      8880
     gaattcatta tgactatcat tggtatcgtt cttgccagaa acgtcttcgc tgttcacaat      8940
     gttgcgttaa atgagaaaat gttctggtaa acccccggag agcacatgca gtgctgccag      9000
     ccctgattgt acttttacct ccctgagtta tgggtacctt gctaagggag tattcaccag      9060
     tgaacaacat aatacaaagt agcgtaaacc ttttgttcaa ggtcagtcag ggtatctcat      9120
     cggaatggtg tgcaatttaa catcgctgcc cagcatgagt tgataggcgt gaccgtgatc      9180
     cgtaccgtgg gatgtgagtt tcatacaggt aatatgatcc tacccacgta atgtggacac      9240
     ggccctaagc gagattatgg ttttcaaatt gttccgggct gagaccgcca caggcactgt      9300
     gacgacgcca gcgattgtaa tcacactcga tataattaaa caccgttgcc cgcattattt      9360
     cccggctgct aaagcgttcc ccgtggatac attccacctt cagcgaatga aagaagcttt      9420
     ccacacaggc attgtcataa cagtaacctt tcgcactcat actgccacgc aggttgtgtc      9480
     gcttcagcag cgcctgataa tcccctgaac agtattgacc accacggtcc gtatgaacaa      9540
     tgacgctttc cgggcgtctt ctccgccaca acgccatttg cagtgcatca caggccagtt      9600
     gtgctgtcat tcgcggtgac atcgaccagc caatgacggc gcgtgaccac aggtcgatga      9660
     ctactgcgag atacaaccag ccctcatcgg tacgcaagta cgtgatgtca cccgcccact      9720
     tctggttcgg gccgctggcg ctgaagtcct gctccagcag attctccaat acgggcaggc      9780
     catgtgcacg gtagctgacc gggctgaact tccggctggc tttcgcccgc agcccctgac      9840
     gacgcaggct ggcagcaatg gttttaatat tgaactccgg catttcgtca gcaaggcggg      9900
     gagcaccgta tcgctgcttt gcctcaaaga atgccttatg gacagcggca tcgcaggtga      9960
     gccgaaactg ttggcgcagg ctcatctggt gacgacgcct gagccagaca taccagccgc     10020
     tgcgggcaac ccgaagtaca cgacacatcg ctttgatgct gaactctgcc cgatgatttt     10080
     cgatgaagac atacttcatt tcaggcgctt cgcgaagtat gtcgcggcct tttggaggat     10140
     ggccagttcc tcagcctgct ccgccagttg tcgtttaagg cggacatttt cagcggccag     10200
     ttcgctttcg cgctctgacg aactcatttg ttgctgctgt ttactgcacc aggcataaag     10260
     ctgagattca tacaggctga gttcacgggc tgcggcggcc acaccgatgc gttcagcgag     10320
     tttcagggct tcgttacgaa attcaggcgt atgttgttta cggggcttct tgctgattga     10380
     tactggtttt gtcatgagtc acctctggtt gagagtttac tcacttagtc ctgtgtccac     10440
     tattggtggg taagatcaga tatcttacct ggatagttct cggttttacc atggtttacg     10500
     ttcttattcg tctggtgaca tacggctatt accggcaaat atcggaagaa actcttgtca     10560
     ggggggcccg ggccagctcc tattttatgg aaagcctgta tggtattgcc acggtaaaaa     10620
     tccagggtat ggtcgggatc cggggaacac actggcttaa cctgaaaata gatgcgatca     10680
     attcaggtat taagttaacc aggatggatt tgctcttcgg gggaataaat acttttgttg     10740
     ccgcctgtga tcagatggcg attttatggc tgggtgcaag ccttgtgatc gataatcaga     10800
     tgacaatagg gatgtttgtg gcatttggtt cttttcgtgg gcagttttcg gatcgggttg     10860
     cttcgctgac cagttttctt cttcaactga gaataatgag tctgcataat gagcgcattg     10920
     cagatattgc actacatgaa aaggaagaaa agaaaccgga aattgaaatc gttgctgaca     10980
     tgagcccggt ttcactggaa accactgatt taagctaccg gtatgacagc cagtcagcac     11040
     aggtattcag tggtctgaat ttgtctgtgg ctccgggaga aagtgtggct ataactggtg     11100
     cctccggtgc cggaaaaacc acattaatga aagtattatg tggactgttt gaaccagata     11160
     gtggaaaagt actggttaat ggcacggata tacgtcaact tggaataaat aattatcacc     11220
     gtatgatagc ctgtgttatg caggacgacc ggctattttc aggatcaatt cgtgaaaata     11280
     tctgtgggtt tgcagaagaa acagacgacg aatggatgac agaatgtgcc agagcaagtc     11340
     atattcatga tgtgataatg aaaatgccaa tggggtatga aacgttaata ggtgaactgg     11400
     gggaaggtct ttccggcggt caaaaacagc gtatattcat tgcccgagct ttataccgga     11460
     aacctggaat attatttatg gatgaggcta caagttctct tgatacagaa agtgaacgtt     11520
     tcgtgaatgc tgccataaaa aaatgaatat cacccgggtg attattgcac acagagaaac     11580
     tacgttgaga actgttgaca ggattatttc tatttaaaat ccactggtgt aactttgtaa     11640
     ggagttttgt ctatggggga ggttaagaag gatataaaaa taacagtgat tgcttttgtt     11700
     atcaattatc tgttctttta tattccggtg tcattatatc ttatttatta ctatggatat     11760
     aattttttta atctatatat gtttttttta tcacttgtag ttacattttt atcgttgtgg     11820
     ttaaacgtga atttttactt cttcacaaat cttatagcga aggtgttgaa atgagaaaac     11880
     tatctgaaaa tgaaataaaa caaatatctg gaggtgacgg gaatgacggg caggcagaat     11940
     taattgctat tggttcactt gctggtacgt ttattagtcc gggatttggt tctattgtag     12000
     gggcttatat aggtgataaa gtccattcat gggcaacgac tgcaacggta agtccctcca     12060
     tgtctccctc aggtatagga ttatcatccc agtttggatc tggcagaggt acatcaagtg     12120
     cctcttcgtc tgcggggagt ggaagttaaa ccttatattg ttaatgaagc acctgtaaca     12180
     ggtgcttcat tatatgataa tggtgcctat gtaacgcggt ttaagttagg ctcttccgaa     12240
     cgtttatcat tttatgcata ccgcatagta acaatgccag tccgtttaat ttttatcata     12300
     tgagattgta acagaaaatg ctctgttaat gagtataact gatataagcc agatattgta     12360
     ttcctgctat gactgcattc atcgacatgt gaagtaatat gggcattaac aggccattcg     12420
     actttatttt tgcactaata agaactaacg ataccagaaa gagcatcaaa aatgtacgaa     12480
     agtcagtata ttgtagatgt aatgcagaaa atatgactga tgttacaata gcagagatgc     12540
     aaatattgtc attaaaccag gatttaaaag agttaaaaag acaccctcga aatacaatct     12600
     cttcatatac aggaacaaga agtacagaag aaaatatatt aatccataaa atggccccgg     12660
     aaaaagacat ttgcgagatc atccattctt ccgttttcct cactgccagc agataaggga     12720
     caaataactg aataatcatt attaaagaga aaagagtaaa aaaaacatcc agtcgaaaag     12780
     aacctcttcc taatccttct ctttttcgga agaaaataaa atacagtgga acaagaatta     12840
     gaaattcagc aagaaataat gctggaacaa gaagccccct agatataagt tcctgcctgt     12900
     ttgtaaggaa tgcaggaata aaggtaatag aaaatgataa agtaaacatt gaaaagcagc     12960
     cgggtgatga ctgttttttt atagttgcat ttttattttt tgttatttcc atttatattt     13020
     ccttacttgt aaaattcttc tatttaacag gaagaggtaa ccatagaatg aatgtttatt     13080
     ttcctgtatc agaacagcca tgacttttat tttatagttg ttatcagtga atgaatgcaa     13140
     actaatagaa caatgagaaa aataatggag aaaaagcgac ggaccggacg ccatagttca     13200
     tattctcgtg tatcagcctc acgtatcaac ctttctgaaa tggtttcggt ttccttacct     13260
     cgttccagaa tatgtctgta atatttcctc atgacatata ccgaaaactg aaaccagatt     13320
     aatatggatg gacacacaac acataaactt ctgatgatat caccagggaa agtatcttgg     13380
     gcgggtaaaa gaaagtcata tactctgaat aaaatcatca tcgagataaa tgagacgcca     13440
     gcacctatcc agtattcgat atgggaagat gcagcattat atgcgtcagt aaaatttttc     13500
     tttcttaatg aaggtggaag tgctgaaagt tcaggaatgc tttttcttgt ccagtatatt     13560
     ttcatatagc aactcatata aaaagtgttc tactttacta tgatgatgac gatttataaa     13620
     aggcttataa tgactacttc tcctttcatt ctcgaatttc acgataatga tagagataat     13680
     cattatcaat tggctgtgtc agtaattttg acttacatca cactttcatg gtttaatcag     13740
     gtgatttatt taatgaaaag agtgtgtttg tggatgtatt gtgtatatgt cttactgggc     13800
     atctgttctt acattaatta atatattgct atataagtat tggtggtatt gtcagtaata     13860
     ttcttttggt taatttagtt attattcctc actgattaat tgtccttccg ttcttattgt     13920
     ttgtaacttg tgtttgtatc gtacctttca ggtgttgatg cgcgctttac tgtgtctgca     13980
     ccggcttgac aaaattcaac agggtttgaa aaggaacatt tcgtgcaaat aacctaagcc     14040
     ttaatttcag agccgggaga catccggcgt tttgttcagc aggcggtgga ccactggcca     14100
     aatctgttgg catttcactt cacgctctat tcggcagaag gaaacatcaa cgggcaacag     14160
     attcatgcat tctgtactgc cttttaccga caggtgcaag aacatattac tgagcgtaat     14220
     cacactgcca gtccagcacc gccggtggta ttacgctggt tgcgggaaca acatggagga     14280
     gcaacaatac gatgcctgtt gctgctcagc caggcgagca tttgccatct gcgggtcagt     14340
     gccacagttg atgaagaatg ttcgcaagtg gtggatttac tgcagcaggc ctggcggggg     14400
     ataaacgctg gcggacaatg tcgggtggaa aggtgttttc gggttacctg gcctgataca     14460
     tcagagcaat acgttgcgtt aaaaacagct gttcagtctc tgataccact ggttattgca     14520
     acaattatcc ggtgatgatc gggagaaata tcaactcttc cgttaatttt tacagactga     14580
     taaagttttg tctgctgaat ctttatacgg aattcttttc agtatgtgta cacgaattga     14640
     ctctatggcg gataaatact gttttacctt ggcggaatta atcctcacgt cttcgccagc     14700
     agtggcagga tgtcctggag gagtgtcggc agactgaggc ggggcagaag aacggctgca     14760
     tattgcactg ctgaatgtgg attacgtcac cagttttgaa ctgccttttc gtctgctttt     14820
     aacccggacg ccacagctga ttgttacact tcgggaagca tgggatatca gccagaaaaa     14880
     tgtggtgttc aacgataaac ggtttggctg cgtgtacagc ctgaaagcca gtctttctgg     14940
     tgtgccggat atattccggt atcatctgtc tcatcgtatt cgccggatgg ttgggagtga     15000
     aaatacatca tcgccatggc agcaaattgc ccgggaagtg aaagcgcccc gtgaacgact     15060
     gaagtatgcg ctggaaacgg gattgcaggt gatcgcactg aacggcctgt tttggtcaga     15120
     cagtcagcgt ctggtggtgg atattctgag gctaagcgcc aacagacgtg atacaggaaa     15180
     tcgtccgcat ccccatttac cgtcttatat cactggcgct gacactgaaa gcatggtcgt     15240
     cagagactct gtctggcaac caagggagca gaggccggag gtaattgaca ggagccttgc     15300
     gccgggttac gtatgttctc cccggacaga caggctcagt ttgtagaatc tacaaattac     15360
     tactactgat gctgccgggg aaaggcgtaa cgaaaaaaca gcctccgtta ccggatagca     15420
     aggaggctga atggagttta taggatttgc gtttttataa tgtctggcca tgcggtaaaa     15480
     ccggacaggt tttattatca tgtgaggtat tctgacataa aatgctggat ttttattttg     15540
     tgacgaatgc tgcaaaattg aatctgcact ctgatgtaac ttttatctgt ttcagtgaag     15600
     tatgcccaca gattgagtta ttaagttgtg gaagaacagc tctgtcccgc ctgcatctct     15660
     cctttcagaa accagtatgt tgccatgcct cgccttaatg gagagcgctg aaccatacct     15720
     tctttttcca gtaataacag gtaatagcgt gcctgataat ccgttaccgc cagcgcctcc     15780
     gcaatttctg cggttttccc tacattatgt ctgctcagaa aacccattat ttcattctgc     15840
     atatcatcat cctctctata taagcaaaag gataataagt ggctgacttg tttttgacaa     15900
     ttcaaatgtg attatcatgt ttttatattg tatttggtgt atttacttaa tatgctaaac     15960
     atattcgcga ttggatttct atcacattat ttttatagtt ttttcaatgg taaggaacgt     16020
     tgcaaaaaac gattttaacg atcttttata ctgaatattc atgcttatac agtattaata     16080
     actaaaacgc caatccactg cgagatataa ccctaaaaat aaacagcttt acagatcaaa     16140
     agatcgtcaa aatacatatt tacaacataa aaaactaaat atatcttaag gagccaggcc     16200
     ctcctgtatg ggggatgaat attaaggcag ccctgtaggt ggcggggtgg ggagtatcga     16260
     atggcacagc atgaagttat tacccgggga ggggatgctt ttttactaaa attacgtgag     16320
     agcgcgctgt catccggctc catgtctgaa gaacaatttt ttttactgat aggtatttct     16380
     tctattcaca gtgacagagt tattctcgct atgaaggatt atctggtcag tggtcattcc     16440
     cgtaaagatg tctgcgagaa ataccagatg aataatggat atttcagtac aacgcttggg     16500
     cgccttacca ggttgaatgt cctcgttgcc agacttgctc cttattatac tgatagtgta     16560
     tcagctatag ctgaagctgc ttccctgtaa aatacggaca ataaaaaacg ccggggcaat     16620
     acataatacg cgagaaatat aagcctgtag tcaaatgaga gtacgggtgt tatcaacgag     16680
     gtatgctttc agcttctctg cttttgctaa agcattcggt gtggagacag gaacactaac     16740
     ccatagctta tcatccaggg aatcttatct atagagaaga ttcctgtcgg ttatccggaa     16800
     aatattatcg ggagataatg tcataaatgc tgcctgagtg tatttctcac attgcattta     16860
     tgaagttctc ctgaaaaaag attcccgtcg ttcgggatat tgattgtgtc tgttgtgatg     16920
     acagatacgg tgtgcgtagt tcaattaaaa acaggaatta aatatgaagt taaaattcat     16980
     ctccatggct gtattttcag ccctgacctt gggtgttgcg acaaatgcgt ctgctgtcac     17040
     cacggttaat ggtggtacag ttcattttaa gggggaagtt gttgatgctg catgtgctgt     17100
     aaacactaat tcagcaaatc aaacggtttt gctggggcaa gttcgttcag ctaagttggc     17160
     gaatgatgga gagaagagtt cccctgttgg atttagtatt gaacttaatg actgtagttc     17220
     tgcaactgcc gggcatgcat caattatctt tgcaggaaat gttattgcta cacacaatga     17280
     tgtgctgtct ctacagaata gtgctgcagg tagtgcaaca aatgtaggta ttcagatatt     17340
     ggatcataca ggtactgcag ttcaatttga cggagtgact gcatctacac aatttacatt     17400
     aacagatggc accaataaaa ttcctttcca ggcagtttat tatgcaacag gtaagtcaac     17460
     gcctggtatt gccaacgccg acgccacctt taaagttcag taccagtaat atcagaacag     17520
     tgtaacggat atatacccgg ccagggaggg ctgtttttat ccatgcgggt gtgagattaa     17580
     tgaaaatatc gaaaatggca gtaatgttat ttttgctgcc tcccgctgca ctggccggaa     17640
     accactggca tgtcatgctt ccgggaggaa acatgcgctt ccagggaaaa ataattgctg     17700
     aagcatgcag tcttgccctg tcagacaggc agatgactgt ggatatgggg caactcagca     17760
     gcaatcgatt tcacgccgcc ggtgagtatg gggaccctgt gggctttgat attcaccttc     17820
     aggactgcag cactgtcgtc agtcagcggg tggggatttc cttttatggc gtatcagata     17880
     ttcacgaacc ggagttgctg tcggtggaag aggagaatga tgcctcagac ggaatcgcta     17940
     tcgctttatt taatgaaagc ggagagctgg taaaacttaa tcagcctccg gagaactggg     18000
     tgcatcttac ccgcggagat atgaaactgc atatgcaggc gaggtataag gccacacatt     18060
     atcccgtcgc cgggggaaag gcaaatggac aggtatggtt ttctctgacc tatctgtaac     18120
     tggcagatat aatgccattt aattaaggct gttaataaca tgatgaagca catgcgtata     18180
     tgggccgttc tggcatcatt tttagtcttt ttttatattc cgcagagcta tgccggggtt     18240
     gctctgggtg ccacccgtgt gatttaccct gaagggcaaa aacaggtaca actggcggta     18300
     acaaataatg atgataaaag tagttacctt attcagtcat ggattgaaaa tgctgaagga     18360
     aaaaaggatg ccaggtttgt aattactcct ccgttatttt ccatgcaggg aaagaaagag     18420
     aataccctga gaattattga tgccacaaac ggacagatgc cggaagacag ggaaagtttg     18480
     ttctgggtga atgtcaaggc catcccggcc atggataagg cgaaaaccgg cgagaattat     18540
     ctgcagtttg caattgtcag cagaattaaa ctgctctacc gtccacaggg actggttatt     18600
     ccgccagaac aggcaccagg taaattagag ttcacccgtg aaaacggagg gctgactctg     18660
     tttaatccga cgccgtatta tctgacagtg actgacttaa aggccggaaa taaaagtctt     18720
     gaaaacacca tggtaccccc acagggaaag gtcactgtga atattcctgg aggatacacc     18780
     ggaggagata ttacttataa aacaattaac gattatggtg ctctgactga acaggtgagg     18840
     ggggtggtga agtaactcag ttatttctgg tactggttgt gtttggctgc tgattttatt     18900
     ttttcgctca gtgtgggggg ctgacatgtt ttccggagat ggcggacaac tcctgtctga     18960
     taaatcactg accggctctg ctggcggggg taataacaga atgagattta atatactgcc     19020
     gctggcattt tttatcggga taattgtttc tccggcccgg gctgagctct attttaatcc     19080
     gcgttttctg tctgatgacc cggatgcggt tgcggacctg tctgcattta cacaggggca     19140
     ggagcttccg cccggcgtgt accgggtgga tatttatctg aatgatacgt atatctcaac     19200
     ccgtgacgtg cagtttcaga tgagtcagga cgggaagcaa cttgccccct gcctgagtcc     19260
     ggagcatatg agtgcgatgg gggtaaaccg ttatgccgtg ccgggtatgg agagactgcc     19320
     ggctgacacc tgcacatcac tgaattccat gattcagggt gccacattcc ggtttgatgt     19380
     cgggcagcag cgattgtacc tgaccgttcc tcagatatat atgagtaatc aggcccgtgg     19440
     ttatattgcg ccggaatact gggataacgg aattacagcg gcattgctga attatgactt     19500
     cagtggtaat cgggtgcgcg acagctatgg tggcaccagc gattatgcct atctgaatct     19560
     gaaaacagga ctgaatatcg ggagctggcg tcttcgggac aacaccagct ggagttacag     19620
     tgccggaaag gggtacagcc agaataactg gcagcacatt aacacctggc tggagcggga     19680
     tatagttccc ctgcgctccc gtctgacgat gggggacagt tatacccggg gggatatttt     19740
     tgacggtgta aatttcaggg gtattcaact ggcctctgat gacaatatgg ttccggacag     19800
     ccagagaggg tatgcaccga caattcacgg tatttcccgg ggaacatccc ggattagtat     19860
     ccgccagaac gggtatgaaa tttaccagag tacgctacct ccaggcccgt tcgagataaa     19920
     cgatatttat ccggccggga gtggaggtga cttacaggta accctgcagg aagctgatgg     19980
     cagtgtacag cgatttaatg tgccatggtc ttcggtgcct gtactgcaac gtgaagggca     20040
     tctgaaatat gctctcagtg ccggagagtt tcgcagtggc ggacatcagc aggataatcc     20100
     ccgttttgct gaaggaacgc tgaagtatgg tctgcctgca ggctggacgg tgtatggagg     20160
     agcctggata gctgaacgct accgtgcctt caatctgggg gtgggtaaaa acatgggctg     20220
     gctgggtgct gtttcactgg atgccacccg tgcgaatgcc cggttaccgg atgaaagccg     20280
     gtatgacggt cagtcatatc gttttctgta taacaagtca ctgacggaaa cagggacaaa     20340
     tatccagtta atcggatacc gctactccac acggggctat ttcagctttg ctgataccgc     20400
     ctggaagaaa atgagtggtt acagtgttct tacccaggac ggagtgatac agatacagcc     20460
     gaagtatacg gattactaca atctggctta caacaagcgg ggaagggtgc aggtgagtat     20520
     cagccagcag acgggggaat cgtcaacgtt gtatctgagt ggcagccacc agagttactg     20580
     gggaacggac aggacggacc gtcagcttaa tgctggcttt aactcatctg tgaatgacat     20640
     cagctggtcc ctgaactaca gcctgtcccg gaatgcatgg caacatgaaa ctgaccggat     20700
     actgtcattt gatgtcagca ttccgttcag ccactggatg cgttcggaca gcacatctgc     20760
     atggagaaac gccagtgccc gttacagtca gaccctggaa gctcacgggc aggctgccag     20820
     tacagcaggg ctgtatggca cactgctgga ggacaataat ctgggataca gcatccagag     20880
     tggttatacc cggggagggt atgaggggag cagtaaaaca ggatatgcct ctctgaatta     20940
     cagaggggga tacggtaatg ccagtgcagg atacagtcac agtgggggtt accggcaact     21000
     gtattatggg ctgagtggcg gtattctggc acatgccaat ggtctgacac tgagccagcc     21060
     tctgggagat acgctgattc ttgtccgtgc accaggtgca tctgatacgc gcattgaaaa     21120
     ccagacgggg gtgtctacag actggagggg gtatgctgta ctgccttatg caacagacta     21180
     tcgtgaaaac cgggtggcac tggataccaa cacccttgca gataatgttg atatagagaa     21240
     taccgtggtc agcgtcgtgc ccacgcatgg tgccgttgtg cgggctgact ataaaacccg     21300
     tgtgggtgtg aaagtgctga tgacgctgat gagaaacggg aaagcagttc cttttggctc     21360
     tgtcgttacg gccagaaacg gggggagcag tatcgccgga gagaatggtc aggtttatct     21420
     gagcggaatg cctctgtcag gacaggttag tgtgaaatgg gggagtcaga ccacggacca     21480
     gtgtactgca gattataaat taccgaagga aagcgccgga cagatattaa gtcatgtcac     21540
     ggttagttgc aggtaaagag gcagggaaat ggtgaaggat attattaaaa cagtgacatt     21600
     ctcctgcatg ctggccggca gtatgttcgt tacctgtcat gtctgtgcag cgggttctgt     21660
     ggtgaatatt acaggcaatg ttcaggataa cacctgcgat gttgacatta actcccgaaa     21720
     ctttgatgtc agtctgggaa gttatgacag ccgacagttt accgcagctg gtgataccac     21780
     acctgcgtcg gtatttcatg tcgggttaac ctcctgcggc agtgctgtcc gtgcagtgaa     21840
     gctgacattt acgggcacac cagataatca ggaggcgggg cttattcaga ttaacagcat     21900
     aaatggagca cggggtgtgg ggattcagct tcttgataag gataaacatg agctgaaaat     21960
     taatgtgccg acaacaattg cgttaatgcc gggaacacag accatagcgt tttatgcccg     22020
     tctgaaagcc acttatcttc cggtaaaggc cggtaatgtt gatgcggtgg ttaattttgt     22080
     acttgactat cagtaaatat aacacagagg aaaacagatg aaactgaaag ctattatatt     22140
     ggccaccggt cttattaact gtattgcatt ttcagcacag gcagtggata cgacgattac     22200
     tgtgacgggt aatgttttgc aaagaacatg taatgtacca gggaatgtgg atgtttcttt     22260
     gggtaatctg tatgtatcag actttcccaa tgcaggaagt ggatctccat gggttaattt     22320
     tgatctgtct ctcaccggat gccagaatat gaatactgtt cgggcaacat ttagtggtac     22380
     tgcggatggg cagacatact atgcgaatac agggaatgct ggcggtatca agattgaaat     22440
     tcaggacagg gatggaagta atgcatcata tcacaatggt atgttcaaga cgcttaatgt     22500
     acaaaataat aatgcaacct ttaatcttaa agcccgtgca gtgagtaaag gccaggttac     22560
     tcctggaaat atcagttctg ttataaccgt cacctatacc tatgcgtaaa tattatcccc     22620
     tctttaagaa aagcactgtc ctcaagggct gtgttttatt cacatttata atggcatatt     22680
     cccagccatc gtttgcattg ttgtgcagaa ataaccagac cgggcaagaa tttaactccg     22740
     gggatacatc ctttcgggtt aatgtcagtc ctgttgtgca atatgataaa tccatatctg     22800
     tattggacct ttcccaactg gtatcatgtc agaatgagga ctcgacaggc caaaactatg     22860
     attatctgaa aatattgaaa ggcagtggtt tttctcctgc tctggatacc aaaacatacg     22920
     gacgactcga ttttacaagt cgtccaacgg ggtatgccag gcaattacca cttcagtttg     22980
     atttgcaggt gacagaggcg ttttatcaat atggtgtctg gaaaccattc cctgctaaat     23040
     tatatctgta ccctgaaccg ggtgtatttg ggaaggtaat taacaacgga gatttactgg     23100
     caacgttata tgtgaataag ttttccacaa aggggcagga ggcaggggag agaaatttta     23160
     cctggcgttt ctatgcaacg aatgatgtcc atatccagac aggtacatgc agggtctcat     23220
     cgaacaatgt caaagttgac cttccgtcct atcccggagg gccggtaaca gtccctctta     23280
     ctgtacgttg cgaccagaca cagtcggtca gctataccct gtcaggtcct gtaacaggaa     23340
     gtggtaatac tgtattcgca aatacggcag catcaggggc cggcggtgtg ggtgtacagt     23400
     tgtcggacaa agcggggccg gttccggccg gacaaccgag gtctctggga caggtaggca     23460
     gctctcctgt gagtctgggg ctgaaggcct cttatgctct gaccggtcag gcaagtctga     23520
     cgcccggtgc tgtccagtca gtgataaatg tgacttttag ctacaactag aatgcagttg     23580
     tggcggtaat gatattactg ctctttatat ccagtttttc atttaatgta tcactgtttg     23640
     tggagaaaaa tagctaataa tagtattgtt tccggtgttg tgacggaaag agtttgtcat     23700
     atggtctttg ttaaagataa acagaaccag tatgagccgt atatctggtt ctgagcgttg     23760
     tcagtaatca taaagataat ggtaaatctg agggtttaaa aatcaaatca gaagaactgc     23820
     gcttatccag ccagaccttc tggtcgggag gggctcatat ttccggagga gtaatgtcag     23880
     ggcagttaac agtatactgg aggtgaaatc aggcagaaca gaatatatcc tctcaccggt     23940
     ttttgagcct gtatggaatc agaccgggaa aatatttgct tttgaaatgc tctcggatat     24000
     ccgttcagca aaagacggga ggaaaatctg cgcatctgtt tttttcagaa gtgtacctcc     24060
     ggatattcag tacaaaatac tcatcagtca gttgaagact gcggaaacgc ttcataaatg     24120
     gtgtctgcag aagaaaataa tgctgagtgt caatatttcc cgggtggtag ccctgtatct     24180
     gagaaaacat ggcatcccgg ggcggccggg aacacatatc aggcttgagg tcagtgagga     24240
     ctttccggca gtggcgttaa aacccggtga tgaccccctg ttacgttttt tgtcagaacg     24300
     tttcaccctc tggctggatg atttcggctc aggaaatgca ggcttaatgt ggggactgtc     24360
     cgggatgttt gaacgggtaa aaataagtca tgagtttttt cattatgccc tgaaaaacag     24420
     gagtgcaatg ccgcttctcc atgctgtggc agacactgtt gcctgtcata accggggcgt     24480
     gatacttgaa ggtgttgaaa atgaagcgtt gttccgtatt gccagagaca tgaatgtcca     24540
     gggctgtcag ggatggctct acaggcgtgt gggagctgat gaattatccg cgattactga     24600
     gctgcatgga taatcctttt tcacagactt gtcagcagcc agcatttatg ttcttttatc     24660
     tgaggaaatt tatctgtccg ctgtgccggg atatctcagt tatacagaaa tcaggcagga     24720
     ataaattgta gtggaaagtc gaagtttacc ggatgactga tgcgcacttg tacacaggca     24780
     gtgtgtttca gtaatatgga gaataatgaa atgaataaca cagacacatt agaaaaaata     24840
     atcagacacc aaaaaaacaa agaccccgca tatccctttc gggaacattt gttgatgcaa     24900
     ctctgtattc gcgcaaataa aaggatgcag gataatatat ctgaatttct gggggcgtat     24960
     ggaataaatc actcagtgta catggttctc accacattat tcacagcgga gagtcattgt     25020
     ctgtcacctt cagagataag ccagaaactg cagtttacca gaactaatat tacccgcatt     25080
     acagattttt tagaaaaaac cggatatgta aaaaggacgg atagcaggga ggatcgccgt     25140
     gctaaaaaaa ttagtctgac atctgaaggt atgtttttta ttcagaggct cactcttgca     25200
     caaagcatgt atctgaaaga aatctggggt tatctgaccc atgatgaaca ggaactgttt     25260
     gaagtcatta ataaaaaatt actggagcat cttgatgatg tcagctcata aagtgtgaaa     25320
     tgcctgactt gttgaaagca gtagtgttgc agaaagacct agtgatgctg atcttatata     25380
     cataagcagc gcccgtgtct gaaatgcagg tcagaaacaa tgtgaacact atccgttaga     25440
     aattgtgaca aaattcccga tgatcgacaa gcgcaccgat tttccagtgg caacatcagt     25500
     acaaaagatg aacggtactg actttgccgg aatgagtcaa aaagaaagct gaactggcac     25560
     tactagcagt gcttcagaaa tttatttgac tgaagtacaa tgaaataaaa aacatatgtt     25620
     atatatcaat ttgatattta tgaaaaatca ataaatttat cttgtgaggg attgcttttt     25680
     cttttgctaa atgatattaa ttatcattct tatataaaaa caataatggc agtaagaaat     25740
     atctggcaag gatgtgagct taacgatcaa acattttaag ttaggcattt attagggaat     25800
     aggaatgaga attaacaaaa tcctctggtc gctaactgtg ctcctggttg ggttgaatag     25860
     ccaggtatca gtagccaaat actccgacga tgataatgac gagactctgg tggtggaagc     25920
     caccgctgag caggtattaa aacagcagcc gggcgtgtcg gttattacca gcgaggatat     25980
     taaaaagacc cctccggtaa acgacctttc agatattatt cgtaaaatgc ctggtgtcaa     26040
     tcttaccggc aatagcgcct cgggcacacg cggtaataac cgccagatcg atattcgtgg     26100
     tatggggccg gaaaacacct taattttaat tgatggtgta ccggtgacgt cacgtaactc     26160
     cgtgcgttat agctggcgtg gggagcgtga tacccgcggt gacaccaact gggtgccacc     26220
     ggaacaggtt gagcgtattg aagtgatccg cggccctgcg gcggcgcgct acggttcggg     26280
     ggccgccggg ggggtggtga acatcattac caaacgtccc accaacgact ggcacggttc     26340
     gctgtcgtta tacaccaacc agccggaaag tagcgaagag ggcgctacgc gtcgcgccaa     26400
     tttcagcctt agtgggcctc tggctggtga tgctcttacc acgcgtttgt atggtaacct     26460
     gaataaaacg gatgctgaca gttgggatat taattctccg gtcggtacga aaaacgcagc     26520
     cgggcatgaa ggggtacgta acaaagatat taacggcgtt atctcgtgga aattaaatcc     26580
     gcagcagatt ctcgatttcg aagccggata tagccgccag gggaatatct atgcgggcga     26640
     tacgcagaac agttcttcca gtgcagttac cgaaagcctg gcaaaatccg gcaaagagac     26700
     gaaccgcctg taccgacaga attatggcat tacgcataat ggtatctggg actggggaca     26760
     aagtcgcttt ggtatttatt acgagaaaac caataatacc cgcatgaatg aaggattatc     26820
     cggcggtggt gaaggacgta ttttagcggg tgaaaagttt acgaccaatc gcctgagttc     26880
     ctggcgaacc agcggtgagc ttaatattcc tttgaatgtg atggttgatc aaacgctgac     26940
     cgttggtgca gagtggaacc gcgataagct cgatgatcct tcctctacca gcctgacggt     27000
     gaatgacaga gatatcagcg gtatttctgg ctctgctgcg gatcgcagca gtaaaaatca     27060
     ttctcaaatc agtgcgctgt atattgaaga taacattgag ccggttcctg gcacgaatat     27120
     cattcccggc ctgcgctttg attatctcag cgactccggc gggaacttca gccccagtct     27180
     gaatctttcg caggaattgg gcgattattt caaagtcaaa gcaggggttg cccgaacctt     27240
     taaagcccca aacctgtatc aatccagtga aggctatctg ctctactcga aaggcaatgg     27300
     ctgtccaaaa gatattacct caggcgggtg ctacctgatc ggtaataaag atctcgatcc     27360
     ggaaatcagc gtcaataaag aaattggact ggagttcacc tgggaagatt accacgcaag     27420
     tgtgacctac ttccgcaatg attaccagaa taagatcgtg gccggggata acgttatcgg     27480
     gcaaaccgct tcaggcgcat atatcctcaa gtggcagaat ggcgggaaag ctctggtgga     27540
     cggtatcgaa gccagtatgt ctttcccact ggtgaaagat cgtctgaact ggaataccaa     27600
     tgccacatgg atgatcactt cggagcaaaa agacaccggt aatcctctgt cggtcatccc     27660
     gaaatatact atcaataact cgcttaactg gaccatcacc caggcgtttt ctgccaacgt     27720
     caactggacg ttatatggca gacaaaaacc gcgtactcat gcggaaaccc gcagtgaaga     27780
     tactggcggt ctgtcaggta aagagctggg cgcttattca ctggtgggga cgaacttcaa     27840
     ttacgatatt aataaaaatc tgcgtcttaa tgtcggcgtc agtaatatcc tcaataaaca     27900
     gatcttccga tcttctgaag gggcgaatac ctataacgag ccaggccggg cttattatgc     27960
     cggagttacc gcatcattct gatcgtagtg tttcaggcgc actgcccgcg taaaagcggg     28020
     cagtgtttag tggcttaact catgacaacc tgctgtgtaa tttgcgtttt caccactgat     28080
     atctaacagt gcctggcgaa aggaggcatt gaacatcggc ccgtgtccca ggttggggaa     28140
     atcccaaaat acggcattga cgcctttatc tttcagtata gtgagggtgg tatgaatttt     28200
     cgacagcacc ccgacagcat gcgtttcccg gttatcaccc tgtgtcgccg agccttccat     28260
     tatcgccagg tgtttggcgc agaattgcag aggctcaacc gccgtaacgc ggcttagcaa     28320
     agcatcataa cctctgccca acgacgggct ggcgctgtag tacgaccgga agtaagagga     28380
     ggacagccag gaatccagca cgaagaggcc gccgtaggag tgcccccata agctgcggcg     28440
     ttgccgatcg atattcagtc cctgttccac ttttggggca atacgcgttt ccagtaactg     28500
     gcggaagttg ttgctgccac cactcttacg gctaaaacgc cctgagtgga gatctgtttt     28560
     tctgctttct gctgctggcg tatagtcgta agccctgctg ttgagatcga aagggaggtt     28620
     ggtctgatac ccgacagcca cgatcactgg cggtgttttt tctgacaatt gtttgagcag     28680
     ttcgtcatcc aggcggtcca taactgcgtt accgtcaagc atatataaaa tcgggtaacc     28740
     cgatgccggt gcggttgtat tcggcacggc cgtccatacc cgataatggc gtgtgccatc     28800
     gacagagtcg aaagaggtgg cgctgaaatg gtaaaacacg gagcctttat cggctatatt     28860
     cggccccagt ggccgcatat ccggcttcgc ataaacttgc gcactacaga taagggtgag     28920
     gcaagaaaga tgaaagaaaa tcgctttatg cgggcgtgtt gagcgatact cgcgggcata     28980
     catctgatga ttattccttt tccgcaggtg acaatttgat ttattcagga agtctgtacc     29040
     gtttcctgaa agtgtttgtg ggtcaactca accctgtagt aaaccaatcc cgtcaatcag     29100
     tgcaccgcgc caccatgcgt aatcgtgacc accggtgtag attgcgcaat ggctttcgac     29160
     gccagcggta atcagccgct ggtgaagttg ctgaacgtga ggcactgtcg aaccttccag     29220
     cgatcccacg cacaggctga tacgcacgcc ctgcggtggg gcagaaagca gatgctcact     29280
     cacccatgag gtatcggttt cgctgaacaa gcctggtcga ctggttcttt ctggcgtcca     29340
     ccacattgaa ggagagtggc tgagcaccag accgaacgtt tccggtgcgt aacgagcccc     29400
     cattagcgca ctgatcccgc cgaggctctg cccggccagc actgtgcgcg aacggtctgc     29460
     ccactgacgc tgcggttgtt cagcgcggat catcggcagc agatgtcctg cgatatcctt     29520
     tatcagcttg ctgcgcccgc cgagtatctc agtgcgttca tgttcattaa tgttgtcaat     29580
     gcccagtaca gccacgggca cgatgcgcct gttatttatg gcggcgtcaa ttgccgcgca     29640
     tacgccaagg tgatcaaacc aggtttcacc atcgggcagc acgaccagcc cgaggggctg     29700
     agaaatatca atgtccggaa tatagagccg aacttggcga gatttcccgg cgataatgcg     29760
     catggaggta agcagttgtc cggtgtggac gccgccgttc cattccgaca gggcgggagc     29820
     tttatcaagt gtcagcactg attcctttgc gtttccccga acgttgatct ccggcatttt     29880
     gtttagcgga tcggcctttc cggcgagggt ggcaaaacgg cctccggaca gtgcaatcgt     29940
     ctcagccgta gtgccggggg ggatttccag cagcgaatag gagccgcagt aacttgcggg     30000
     taaacgcagt gtcagtgtcc agatatccgt ttcgggaagg gcgctcatca ttcctttttc     30060
     tacgtgctct ttatccgtca cccggttcag acgcagataa acgccctgca gaggatgtcg     30120
     ggcgcgccac agaaaggtca cttctcgctc atcttccgct ccttcgactg gcgtcacaag     30180
     aggaacattc agcgactcag cttcgcgcca gaagtcagta aggttagcaa tgtggcccgc     30240
     tgccagttgg ttgcgcaggc tggcgatagc agagggatgt tgttgcatgt tcagcattca     30300
     tactctttaa aaattaagga tgtcagtata aataattaaa gcggctattc acggtaccgc     30360
     cgcttctgac tgtgttttta atacattacg tgtccagtaa ctatcccggg gtttcctcct     30420
     tcatgttgtg ctggcgatgg agcgcagtac tgctgacgct gtcatgccat aagcgggtat     30480
     agaggccgcc tgcagataac agctgttcgt gggttccgta ttccgcaagt aaccccttat     30540
     caataacggc aatcagatcg cagcgttgcg cggtggtcag acgatgtgca acaatcagcg     30600
     ccgagtgctt cccggcatgc acgacatctg ttaacgatga catcagtcgt tcttcggatg     30660
     tgcgatccag acatgacgtg gcttcgtcga gcagcaggat gtgagcattc gccagttgcg     30720
     cgcgggccag cgcaatcaac tggcgctgac ctgcggacag atcggctccg ccgttattca     30780
     ccggtgtccg gaatccctgc ggcagattgc acaccatctc atacagccct gcccgctgtg     30840
     aggcaatttc aacgtcttca ttggtggcgg atggccgtga ataacgaatg ttttctgcaa     30900
     tatcactact aaacagtgct acatcctgat cgacaagccc aatctggcga cgatactcag     30960
     tgagcgaggc atcatcgagc atttgcacac cgattctgat gttgccgtgc gtggggaaat     31020
     acaacccggc aatcagctta atcagcgtcg acttacccgc accgctgcga ccgacgaccg     31080
     cgacaaccat tccctcaggg atcgtcaggg taagtttgtt cagagctggc tcgtgactgt     31140
     cgggataact gaacgtgacc tcatcaagat gcagtgcacc ggtgacaggg aggaccgaag     31200
     aggacccgag gttctcagtg ccttctgtcg ccagtagttc atcaatatgt ttgccgctgg     31260
     ctgtcgcctg ctgccaggcg tcgacaatcc ctgataactg ctgcactggc ccatagaatt     31320
     gccccagcaa caggaagaaa gccgccagta ccccggcagt catttctcca gcggcgacct     31380
     gcgaagctcc cactaacaga acggcggcat aggaggcctc ggtgcagaat gtcagaaacg     31440
     gaaaatagac tgcaaggtat ttttgtgctc gcacacgggt tgcgcggaaa cgctccgata     31500
     acgcgcgcag ccgggcgccc tccagttcct gctgaccatg cgattgcacg acacgcaggc     31560
     cggagacttt ttcctgcagg gtgctgttga ctttgcctat ttccagccgt gcctgtgcat     31620
     aagcaggggt actgaggcgg cgataaatca tggttgccag tgcggccact ggcactgcgc     31680
     ttaatgccgt cagcgccagg atcgggtcga gccagaacat ggtggcggcg attgcgaaca     31740
     tcgtcaccag actggtggcc gcaccggcaa ggccgttttg cagaaagcgg gcgagagagt     31800
     ccacatcaac ggtcatgcgg gtcagacgcg aatcggcatg cttttcatgc caggggagtc     31860
     caagacgcag catatggccg aagctgcgca agcgcaccga atgctgaact gattccgccg     31920
     ctctggcggc gaagaccgtc tgcagagaat aactgcacca gcccacaatg accaggcaca     31980
     gggcgagcag ggcacagagg ccgatggtcg acatatcgcc tgcggcgaca ccggagtcaa     32040
     tgccgtgctg caacagtatc agcaccccta cgcctgccgc agaatcgagt gcgatcagca     32100
     gagcggcgat gacgaacatc catgccacag gcttcagtag tgacgtgact ttgcgacctt     32160
     taccggccag cgcctgctgt actgcatttt ccggtacgcg ggtcatacgg gcgacaaaac     32220
     ctttatcccc cgtatccgtt acatcgtctt gtgtcgctgg ttcagccggc cacaattcgt     32280
     tgtggctatt gtgggacgtg gccagaaaat cgctgtcgcc ggtcatcagt gcgcggaacg     32340
     ccggacagcg cgcttcaagt tctgccgggg ttccggtatc caccatacgg cccttatcca     32400
     gcaccacaac ccggctggct agctgaagcg ttgaacgccg tcgggcaatc accagcagca     32460
     tatgcccttc gtcagcatag cgacccagcg cggtattaat ctccgcttcc gtaacagcat     32520
     caaccgctga ggtggtatca tccaggatta acacgtccgg tgcagtaatg agcgcccgcg     32580
     ccagcgctat tcgctgcctc tgcccgccgg aaagattcgt accccgttcg gttaacaggc     32640
     tatcgaagcc tttcggcagg gcgttgataa aatcgctggc tcctgcagca gctgccgcac     32700
     ggcgaatgtc gtccgccgtt gcctgagggt ggccataggc gatattttcc gccaccgtac     32760
     cggcaaacag aaaagcatct tcaaatacga tgcctacccg gcgacgaagc gcctccagtc     32820
     tgatatcgcg aagattttgt cggccttcgc tggtgttgag ccatatcttt ccggagcagg     32880
     gatcataaaa acgcgccagc agcatcaaca gggtcgattt tcctgaaccc gatgcgccca     32940
     ccaccgccac ggtttccccg gcgcgcaggg aaaaggagat atcgctgagg atatgtctgt     33000
     cgccatggtg gtagtcaaag ctcatattct ccagttccag tccgacaacc tgactgttaa     33060
     tcgactccgt cccgtcctcc atctgtgaac gggtgtcgat cagtgcaaac acccgctccg     33120
     cggacgcctg agtgcgctgt gcgataacca gaaacgatgc cagtacgcgg gttggcccgg     33180
     tcagcatcgc gaggaagctg gcgaatgcaa cgaaggtacc gagatcgatc cgcccgtgca     33240
     tgaccgacca cccgccgtag cacagcagga cgatttgccc gagcaccggt agcgccagca     33300
     tggtggcccc aggcatcgcc tgcgagataa ccgcaccgat gcgtacacgc acaatctgcc     33360
     gcgactgcct atcgagccag tgcgtttcac gcatctctgc cacacaggat tttaccactg     33420
     agatctgtgc cagcacctcg cgtatatgtt cggtgagatt cgccagttgg tccgaggcca     33480
     ttccggtttg cgcgaagacc ctacgacgcg cacgaagcgc ggtgatcgcc aggcatacca     33540
     gtacgcacac gacgataagc gtcatggcag gggacatcca cagcatcacg gcaatgccgg     33600
     caatgtaata agtgaacact gccagcggca ccgggcacat ctgcagcagg gtatgcacct     33660
     gctgcagatc gctgttggtc cgtgaaatca cctgcccggt gcgcagcgca tcctggcctg     33720
     cgccgtcaag tttttgaata ctgtcgaata cccgtcctct gagggtatgc tgcacccaga     33780
     gtgagagcat cccggcataa ccacggcgca catagttacc gatgaaatca aaaaaagcga     33840
     tcaacagtaa cccgcaggcc agccacggca ggcgggccgg attgcccgcc agtgcgtcat     33900
     tcacagcctg tcttgtcagc agtggcgtca gcgcagccag caaaatagtc gatactgacg     33960
     ctaccaccac gatgacacta agtttcttac gttcccagca cacgcgcgcc aggcaaacta     34020
     tccatgactg agccggtgtg ggagtgtgat tcgcaggcat taagcctcct ccgtctgtaa     34080
     aatacgatcc actggccgga tcgttccgca aaaaagccag cacactccgg tcccgcattg     34140
     ttatggatgc atgacttctg gatgggggct ggcatatgat tatcatgaag gtgtagtggc     34200
     taccctttct gtaccattgt gatcaggctt ttcgccactt cacctgggca gggttgcgcc     34260
     gccatttccg ctgctacctc ttcagaggct ttgcgaagtg agcgattgtt gaggaaagca     34320
     ttgatcatgt tactcgacag gccgacgtcg cctgggataa tcccgcagcc gcgttcggca     34380
     acaacgcggg catttaccgg gcgatcggct ccctggccga agacgatttg tggaatacca     34440
     gcgtgtagcg ctgtcagggt attgcctgct ccgccatgat gaatgaaacc atctgcgccg     34500
     ttgaggaaga cacccatggg tatccagtca accaggcgaa catttgatgg cagcgagcgc     34560
     aaatcggacc gcgcattggc tgaaatatgc agaatgatct cggcatcgac ctcactggca     34620
     gaatccataa cccaggcgat tagatcaagg ccgtcaacca tcggtttgac agtgccgaga     34680
     ctcaccagaa gacgtttacg ttcgggcctt ctctcccacc atggttccca caccgcacca     34740
     ccgttatacg ggacgtactg catcggaata atgggttcac cgtcgttttc cagaatgctc     34800
     atactcggcg gtgttacgtc gatccaggcc atatcgcgtg gtgtggcccc gacattgtgg     34860
     cgacgatagg cgtccgtgag cgaacgcgtt acacccctga tatgccaggg ggtatggccg     34920
     aagcctacgg tttgcatcac gaccggtata tcatatttgg cggcaatcag cggcccgatg     34980
     actccgagtg gagggtagat gatgaggtca ggccgccagt gtccggcaaa ctccaccaga     35040
     tggtctgcca tttcttcgct gaagaatgag aagttgccca tttgggttcc gatgttactt     35100
     tttttccgct gtgcctcatg gtggcggtaa ccagcttcgg aatccagacc gggggcagcg     35160
     tcaaacacca ccaacccggc ctctgccgct ttttgtgcga attgtcctcc gctggcgatc     35220
     agtacttcat gaccgttaac gcgaaatgcc tgcgccaggg acagcacagg atacaacagc     35280
     ccatagagag gcgggcctac aaacaaaatg cgcatgagaa aatccctctc cgcttgacga     35340
     tctaaatcag gcaatcgacg cactcatatg ccagcagcag gacacgactt ttcgttaaac     35400
     ctgctttacc agatgctgcg ccatttgtgc ttcaccagcg ttatggacag atcagtcaga     35460
     gacttttccg tgacatacac aggtgaacag ggaactccgt atccccactt ccattaacgc     35520
     ttacgcgcca ttgtcctgtt gaacatcccg gcgtcggaca gctacgccgg gatgttctga     35580
     cgcatttgtg cagtgttaga ccgacaatga atctggaaag atccgtgact ttttagacac     35640
     acggcttgca tcatcctgat agtctcgcct tcgctggcct gtaagtaaaa tgaccttgta     35700
     ctggcgatgc gtgttccctt tcagccttac cagagacaac gttagcgcaa atgctaatga     35760
     taataattac caatatcatt aatgtattgc aacgataatt aaaaacttaa tgaaaaggga     35820
     agcactcaga ggactatccg ggggtattta aattgaaacc tacgctgctc cagaccgtgg     35880
     agaatatttg cctgcaaatt ctgttcgtgc tgttccagtt caccggaacg ctgatagacg     35940
     ttgaggcatt ggtgagctgt tcttccgttg ccaaaaatgt acagagaact ccggccagca     36000
     gcgtttcatc ctctgtctat agcgcaagcg tgtcgagaac tgctgctgat attatgctgt     36060
     tgtcgaataa tccgcttttt gctccgggtc aggtgagttt tttcggctgt tcgttggcag     36120
     cgtcaggtat tcacgtcacc attctggagt aatgccagtc aattaagcaa ctgactggct     36180
     ctttttcggg gctgtggggt atttccaggg cctctccttt accactctcg ggaaggccct     36240
     ttcccttctt gtcggtaatt tcacaagttg tcccatactt gcaagatcgc gcatcagctc     36300
     cggtatacgt cccggtgaag cgccctgcaa tgtcatcagc attctcatca ccattccgca     36360
     tgattctgag aaactcagtt gattcggcca gtaacctttc agatgttccg ccattttaat     36420
     catctgatat ctcaccagat tataagccag taagacaccc cacagctctt gctccacaag     36480
     ctccggcttt ttacttctca gcgtcagcct gctcagttgc atcgtctgtt ttatctctct     36540
     gtatccctgg tcaggttgac ggggcactag tggtttcagc ggttaatcgt cgaacaggcg     36600
     cgagacaata ttcgcattca acaaaataat aaacgcaaca ctgatcgttt tgttgagagg     36660
     ataactcttt ttcagggtta tgggtgaaag gcctgaaaat ttgcgattat ctttaagaga     36720
     gtcacaaata tactccaaaa cccgctctct cattctttag actgaactta gcgtagctca     36780
     ccatgtcaaa atgtttgaaa ctgctctggt gtgggaagtg ttcgaaaact cgtagattgt     36840
     tatttcaatc agtgcgcaaa agagtgtctt actgaaaaat gaatatagat attcatctgg     36900
     cgattcgaga cgaaaagatt tctttcatcc gcagttatgc gcatggttaa gaggtgacga     36960
     ttgaagaagt cctgatctta ctgaagttac gcggatagtg ggtaatgccg cgagattgat     37020
     ggaactttaa aaattatctc ttaacgtttt acggatataa aaagtttatt ttttgttaag     37080
     agagattact tcaccagaca acttgaactc gctgcagggc gtttttttat gcccgaaaag     37140
     ctgcacagta cgttaaatat gctggtgatt gtgcagtgag tttctccaag cctgatgcga     37200
     cttgactgca tgatatcaca tttgtaatgt aaaataaatc aatgttttta agttgctagg     37260
     tgcttgtttc tatagctggg gtacttcctt ttactatggc tttccatggt ggggggcgga     37320
     gctggtgttg atgatgtggc cagaagcctg ttttatgctg ttacagtcat cgttatattc     37380
     cttattggat ggggagcagg tattgttttc tttctgggaa ttaaacaaaa aacaatatga     37440
     atgatttgag ttttatcaga ttttttctgg caatattgtt gcttcttgtt cctcctgctc     37500
     tggagttttc agtaattcat cggcacatta cgccaggtgc actgacttta tgcgtcatta     37560
     cagccttaat aattacgctg cttgccagct tgggcggcag gcttgtctca gttaaatgta     37620
     tttcggagat ttcgtttatt cgtcgtcacc ggattgagtg catgatggcg ggatttatga     37680
     tttatttctg gacattctct cttattgctg gttgatacaa gccccagttt aagaaggaat     37740
     atcagacact ccactatgag aatgctaggt attacgttct tgcacgctat gacggtcgtt     37800
     tggttttatc acaatcgtac aggaacggga gtaggaagtt tgttataatc aatggcggac     37860
     atagactttg agattaatgt agtcagagtg cgttaaaatt cccttagaaa tcgggaatag     37920
     gtagtactag atacgcagga tttaatcagt cgtattgaga tggaattgca gagttaaact     37980
     ggcatggata ttattttgta cccagccctt aagaacaatg gtgagagata gtaactcata     38040
     atcgccaatt cactgtttta aatttagtaa gggccgctat ccgccactgg ctcatcggga     38100
     aagagcatca gccttctaag ttgactgtgc gaggttcgag tcctcggtgg cggtccagta     38160
     ctgatttagc tcagtaggta gggaattgcc ttgtaatcag taggtcacca gttcgactct     38220
     tgctgtctcg ccccatattc caataggctc gctttgacgg ggcttttgta tgtcgcttgc     38280
     gatatgttac agtaccgtta tcagtctgta gaaaatacac acaggagtga aatgttaaat     38340
     tacccacaac tcagagagcg gagtgttgtc ctgttagtgg ggaatttgtt aaaagaatcc     38400
     agcatggtga atctccctgt gcggctgtct cttgatcaga tctcctgatc aagagacttc     38460
     atcaccggat aaccctcaac catatcctga agtctgaacc agccatccca cataactacc     38520
     caaccagggc ggcctgtgcg tttgctgtca tgccatcgcc ccagtttcag acaggcccat     38580
     ttcagtgtcg gcgtctgtga cggaagctgt tttccttcca gcttaaccca cagcagtttc     38640
     cactctgtcg gcgtcagtat tttcttacag ctgtcatttt gtgtttcttc actgatacct     38700
     tcctgccgca ggcccagcac ccgtaccgcg ataaacgcct tgataaccac catgcgctca     38760
     aggttatccc gggtctgcat tcgcagtgat tccacacatg taccaccact tttccacgcc     38820
     ttgtggtatt cctctatcag ccagcgtcgc tcgtaatggc tgacgatacg tcgcgcatcg     38880
     gcggcactcg ccactttttc tgatgtcagc agatgccagc aggcaccgtc ctctgactgc     38940
     tcccggcaac agacatacgt gagcgggagc gcctggccgc tgttgtcgcg atttttatgc     39000
     tgacttcgct gtacctgatg aacatccggg cctggcgggc tgcccgccct cctttttgca     39060
     tcacattcag cgtgtggctt cccgcggttg ccaggacttc cggcagttcg aagagcttgc     39120
     cgggtgcttc ttccagccgg ctattctgtg cagcacgcac cacgaagcgc tgtccgtggc     39180
     tgactttata atgcaggtaa tgccagatat ccgcttcccg gtcacagaca gtaattaccc     39240
     gtttctgtat ctcccccagc cgttcggcca tacgctccga agcctgctgc cagcggtaac     39300
     tttctttttc ttcacaggga cgttcttttc gctggtgctt aacaccgtag gtgtccgtga     39360
     cccgactcca gcgctgctgt tcgataaaac cgactggcag ggcgctgtca ggggcgtaca     39420
     tcaggacaga gtgagccagc agcccgtgcg tcttcgggtt agtggtggta ttcccctggt     39480
     catcagatgc cgtactgtgg ctgaagttaa tggtggtggt gtcttccagt gcgaggagca     39540
     gcggatgagc ctcacatgcc cttacagtgg cggtaaatcc ggcttcggca atggcttgcg     39600
     gggacacaga cgggttacgt atcaggcggt acgcaccttc aacctgagca gtggactggg     39660
     atgatttcac aatagaaaga cctgcatgct gagcgggaga agaggtcagt gacacaaggc     39720
     gtcgtgtacg acgcggatca ccgagacggg catgtccaga ctgctcgtta tcccatgaat     39780
     aacaatcaga aagtaccata acagacccga agaaaatgaa atataagaaa agatcaacga     39840
     gtgaagaaaa agttcaaaaa atggctgccg gggaggaagg aaagtaccgg atggaaagag     39900
     tcccccctaa agcagactga cagacataac aaatccccgg ggggatttgt gtataagaga     39960
     cagtacttat ctggaggtaa ttgcaatatc tctgtgaact tacacagggt gggcttaccg     40020
     catacactga cacttagcgg atcgacagaa cattattaac agagcatcac tgaacgctac     40080
     ataatcagag ttgcataaat aaaatgttat gatataatat cacaatcaca acatttgttt     40140
     tcgaatgtat atgaatgtaa tcagaactgt catttgtaca ttaattatac ttccggtggg     40200
     actacaggca gcgaccagtc attcttctat ggttaaagat acaatcacca ttgtcgcgac     40260
     aggaaatcag aacacggtat ttgaaacgcc gtcgatggtc agtgtcgtca cgaatgacac     40320
     accgtggagt cagaatgcgg ttacatcggc cggcatgctg aaaggtgttg ccggtctcag     40380
     ccagactggt gcaggacgga ccaatgggca gacctttaat ttacgcggct atgacaaaag     40440
     cggggtactt gttcttgttg acggcgttcg ccaactcagt gacatggcaa aaagcagtgg     40500
     cacttatctg gatccggcac tcgtcaaacg tatcgaagtt gtccgcgggc caaactccag     40560
     tctgtacggc agtggcgggc tgggaggtgt agtggacttc agaactgccg atgcagcaga     40620
     ttttcttccc cccggagaga caaacggttt aagtctgtgg ggaaatattg ccagtggtga     40680
     ccacagcaca ggctcggggc tcacctggtt tggtaaaact ggaaaaacag atgcgctcct     40740
     ttctgtcatt atgcgtaaaa gaggtaatat ctatcaaagt gatggtgagc acgcacctaa     40800
     caaggaaaaa cctgcagccc tgtttgcgaa aggctctgtc ggtataacag acagtaacaa     40860
     agcaggtgcc agcttgcgtc tctaccggaa taacaccact gaaccgggca attccactca     40920
     gacacatggt gacagcggtc tgcgtgacag aaaaacagta caaaatgacg tacagttctg     40980
     gtaccagtac gctcctgtgg ataacagcct catcaatgta aagtcaacgt tatatctcag     41040
     tgatatcact atcaagacaa acggtcacaa caaaacggca gaatggagaa acaacagaac     41100
     ctccggtgtt aatgttgtca acaggagtca tactctgatt tttccgggag cccatcagtt     41160
     aagttatggc gctgaatatt accgtcagca gcagaagcca gaaggctctg ccacactata     41220
     tccggaagga aacattgact ttacatcgtt gtatttccag gatgaaatga caatgaaaag     41280
     ctacccggtt aacattatcg tcggttcccg ctatgaccgg tacaagagct tcaatccccg     41340
     tgccggagaa ctgaaagccg aacgcctgtc cccaagggcg gcgatttcag tctcaccgac     41400
     agactggctg atgatgtacg gctccatatc ctctgcattc cgagcgccca caatggcaga     41460
     aatgtacagg gatgatgtac atttttaccg caagggtaaa cccaattact gggttcctaa     41520
     ccttaatctg aaaccagaaa ataacatcac ccgtgagatt ggcgcaggta ttcaactgga     41580
     tggcctgctt acagacaatg accggctgca gttaaaaggc ggatatttcg gaacggatgc     41640
     cagaaactat attgccacac gcgtggatat gaaacggatg cgttcttatt cttataatgt     41700
     atcccgggcc cgtatctggg gatgggatat gcagggtaat taccagtctg attatgttga     41760
     ctggatgctt tcttataacc ggacggaaag tatggatgcc agcagcaggg aatggctggg     41820
     ctccggcaat cctgacacac ttatcagtga catcagcata cctgttggtc atagaggcgt     41880
     ttatgccgga tggcgtgctg aactttcagc atcagccacg catgtgaaaa aaggcgatcc     41940
     ccatcaggct ggttatacca tacattcctt ttcactgtct tataagcctg taagtgttaa     42000
     aggctttgag gcgtcagtaa ctctggataa tgccttcaac aagcttgcca tgaatggcaa     42060
     aggtgtgccg ctttcaggca gaactgtcag tctttatacc cgttatcagt ggtaacctcg     42120
     caggaaataa atcatgatga aaaatacagg ctatatctta gctctttgtc tgacagcatc     42180
     ggggcatgtc ctggcccatg atgtctggat tacaggtaaa caggcagaga acaacgttac     42240
     cgcagagatt ggttatggtc ataatttccc ctcaaagggg acaattcctg acagaaggga     42300
     tttctttgaa aatccccggc tttataacgg gaaagagaca ataacactga agccagcgtc     42360
     cacggattat gtctataaaa ctgagtctgc aagcaaagat aatggttacg ttctgtcaac     42420
     gtatatgaaa ccgggatact ggtcgagaac ctcgtcagga tggaaaccgg tcagccggga     42480
     gggcagaaat gatgtggctt actgtgaatt tgtcactaaa tatgcaaaat cttttattcc     42540
     tggtgaacag cagatgccag cacaactcta tcagtctcca acagggcatg agcttgaaat     42600
     cattccgtta tccgatataa gtcgtttcag tgaaaatgtg aagctgaaag ttctgtataa     42660
     aacgtccccg ctcgccggag ctatcatgga gcttgactcg gtcagttatc tgacatcatc     42720
     ccgtcatact catgcagttg agcacaaaca tcctgttcat aaagcagaac tcacctttgt     42780
     aactaatgag gatggtatcg tcacagtacc ttctcttcat atcggacagt ggctggcgaa     42840
     agtccaaaat aagaaaagtt ttcaggacaa aagcctgtgt gatgaaactg tcgatgtggc     42900
     aaccttaagc ttctcccgaa attaatgata ctattcctgc cctgtatttt acgggcaggg     42960
     tatatcaacc ggaaatagcc tactgacatc catgtaaaaa aactcataat tattttgttg     43020
     atgtatctta cctaatacat tgatagctcc agtttttata ccagagcatt ctcgttgtcc     43080
     ctatgtactt gtctgcaata tcactgatat gcaggaataa tattcttggc atggagtcag     43140
     ttccccgtca tcttaggtat cactttaact cacaggtgtc cagtaaatat gaacaggatc     43200
     ccagtaatca ttatcaatgg tttccttggc gcaggaaaaa ccactcttat gaaaaacctg     43260
     ctcacacagg caaacaggaa tcacttagct gtatctgtca ttgtcaatga tatgagcgat     43320
     ctggatgttg atggtgtact tattgcaaat acagaaatcg ttaatattgc gaacaataat     43380
     ttcgtgagta tcacatctga tagtatcagc agccagagtg ggattaagac ggtcgacaag     43440
     gcaattaaaa atatgctcag gcattatttg cctgacgtta tatttgtcga aacatccgga     43500
     ggtagccacc cactgccatt aattaagtat ctgcagactc atgagcgatt acagctaaaa     43560
     tcacttttat cacttgtcga tatcgttatg ctcaatgatg actataacgg agggaaagca     43620
     ctgatacctg catttcagga gaatcttttc tatggcaagc gcagaataga gaatttactg     43680
     gctgagcaaa tcatgttttg tagcactttg ctgttaacca aaaaggatcg actgtcattc     43740
     gacattgtca ccgatgtggc gaaagcaatc catcctctga atccttacgt aaatgtgata     43800
     gctgtgtcat gggggaacct taaactagca gagttactaa cccttccgga ttacgatttt     43860
     aaccgggtcg gattacttat cagagaactg gaagacacaa tcacagtaga agaagcaaaa     43920
     atttcagccc aaaatggcga aataatttcg cgagtgatta aagatgacag gccattccac     43980
     ccacaaagat tatgggaaac ctatcattat tttatgggaa tgggtattta tcgtagtaaa     44040
     ggctttttct ggctaccagg aagacctgac atggctctgc tctggaacca ggccgcagga     44100
     agtatcaatc tggagtttat cagctactgg aattccggtg tattggcaga ccctgataat     44160
     cacctgaccc acgaagagcg ctctgttttg cagaaaaaag tcaataaaac tatggggcgg     44220
     tttggagaca ggagatgcca tttaacgatt atagggcgtt ctgatgaagt ccatgatttt     44280
     acctccgcct taattaactg ttttctttct gaagaagaaa ttgtctggtg gcaatcaggt     44340
     ggcgttttcg cggatccctg gcccgttaat atatcccggc tgaactgatg attaacgcga     44400
     tattgcaaat atggcatatg aatcgatcgt agtttggcat tcgaatcgat catgatttgg     44460
     gtaaacgttc acggagcgcc gtattgacgt ttatttattg ggtgagtacg acgttccatg     44520
     gcaggagttc atcaacacgg ttagaaggcc attccggcag gacgttgagg atatggcgca     44580
     gatacgcttc cggatcgata ccgttcagtc ggcaggcgcc gatcagcccg tacagcagcg     44640
     cactacgctc tccaccgtga tcgttgccga agaacatgta gatgatatga cctttatata     44700
     ctcactatag cattggtggg atattccaga ggaggtcatc atgtattcgg aaaatattgc     44760
     ggcttacgtc gggctggatg tgcataaagc cccctagcag ttgctattgt tgcatctgaa     44820
     cgacttggca aggttcgtta ttatggtacg attaacaacg aagcccaaac tgtacatcga     44880
     attcactgac aatatgcgtt atgacacgct ggagacctgc catcgtaatg cgttccgctt     44940
     ctttggtggt gtgccgcgcg aagtgttgta tgacaatatg aaaactgtgg ttctgcaacg     45000
     tgacgcatat cagaccggtc agcaccggtt ccatccttcg ctgtggcagt tcggcaagga     45060
     gatgggcttc tctccccgac tgtgtcgccc cttcagggca cagactaaag gtaaggtgga     45120
     acggatggtg cagtacaccc gtaacagttt ttacatccca ctaatgactc gcctgcgccc     45180
     gatggggatc actgtcgatg ttgaaacagc caaccgccac ggtctgcgct ggctgcacga     45240
     tgtcgctaac caacgaaagc atgaaacaat ccaggcccgt ccctgcgatc gctggctcga     45300
     agagcagcag tccatgctgg cactgcctcc ggagaaaaaa gagtatgacg tgcatcttga     45360
     tgaaaatctg gtgaacttcg acaaacaccc cctgcatcat ccactctcca tctacgactc     45420
     attctgcaga ggagtggcgt gatgatggaa ctgcaacatc aacgactgat ggcgctcgcc     45480
     gggcagttgc aactggaaag ccttatcagc gcagcgcctg cgctgtcaca acaggcagta     45540
     gaccaggaat ggagttatat ggacttcctg gagcatttgc ttcatgaaga aaaactggca     45600
     cgtcatcaac gtaaacaggc gatgtatacc cgaatggcag ccttcccggc ggtgaaaacg     45660
     ttcgaagagt atgacttcac attcgccacc ggagcaccgc agaagcaact ccagtcgtta     45720
     cgctcactca gcttcataga acgtaatgaa aatatcgtat tactggggcc atcaggtgtg     45780
     gggaaaaccc atctggcaac agcgatgggc tatgaagccg cccgtgcagg tatcaaagtt     45840
     cgcttcacaa cagcagcaga tctgttactt cagttatcta cggcacaacg tcagggccgt     45900
     tataaaacga cgcttcagcg tggagtaatg gccccccgcc tgctcatcat tgatgaaata     45960
     ggctatctgc cgttcagtca ggaagaagca aagctgttct tccaggtcat cgctaaacgt     46020
     tacgaaaaga gcgcaatgat cctgacatcc aatctgccgt tcgggcagtg ggatcaaacg     46080
     ttcgccggtg atgcagcact gacctcagcg atgctggacc gtatcttaca ccactcacat     46140
     gtcgttcaaa tcaaaggaga aagctatcga ctcagacaga aacgaaaggc cggggttata     46200
     gcagaagcta atcctgagta aaacggtgga tcaatattgg gccgttggtg gagatataag     46260
     tggatcactt ttcatccgtc gttgacattc ccggtgacaa catgggccag aagcccctct     46320
     ccggcataac tgcgtgcaat gggttttgaa ggcaccggtg cctgcacgat atggtcgcac     46380
     cggcaacagg ccagtttcgg acgttgtgtt tcgataacct taaaggcgct gctgataagc     46440
     tccagttgct ctgacacatc acaccccaga ggactgaggt caccaccaca ggccgggcag     46500
     cattcctctt ccggtcggat gacccgggtt tcatggggaa gtaaggctgg taacggttta     46560
     cgggctgaag actggcgcag ggaagatggc agtaccgggt catattgctc acccagtgtt     46620
     tccgccattt cttcctgaag tgcactgatt cgctcctgtg cttcctgtat ctgccgttcg     46680
     gtttttgcac gaagtttttc tgagctttta ccgaactgca tacgctgtag tttcgcaacc     46740
     agcgccttca gccggttgat ttcggaagca taagtcgcca cccgctgtga gagcaggcgg     46800
     ttgtattctg ccatctgacg gatggtgtcc tgttgcgtct gcaacagtgc ccgcaggcgg     46860
     gcattctcat gagcaagtga ggtgtccata tcctcacttt acaacgggtt atatacggat     46920
     tccagcgcgt tccgttcgtt tcgggtgctt ccagttgatg ccctcaagaa gcatggacaa     46980
     ctgagccgga gtaaggtgaa cctttccatc gcgggtgacc ggccagacga agcggccccg     47040
     ctccaggcgt ttggtgaaga ggcacagtcc gtcactgtca gcccacagca cttttatctg     47100
     gtcaccccgg cgtccgcgga agataaacag gtgtccggag aacgggtcat ccttcaggac     47160
     gttctgaact tttgatgcca ggtcgttaaa gccatttcgc atatcggtga taccggcaac     47220
     cagccagata cgcgaacctg cagggagaga tatcatcgtc ccctcccgct cagttcacgg     47280
     atcaacaccg tgagcagctc tggtgaagga ttttccagcg tcattttacc gtgacggaac     47340
     tccactttac aggaactggc actggctgtg ctctgtgaag gagtggataa aagcggggga     47400
     agagtcgcca tcggttcttt cggctcatca ggcgttatct ctacaggtaa taattcaacg     47460
     ccagcgccag aagaggttgt taccggaaga cgctgcgata tacgcccttc gttctgccag     47520
     agtctgagcc atttgaacag gaggttatca ttgatatcgt gtccccgggc aatacgggca     47580
     acagaggcta ctggttgcaa atccagttta accatttgaa gtttaaactc atttgaaaat     47640
     gatctgcggg gttctgcgga taatgttttt gttccataac aggtgcccac tagtttgaaa     47700
     aggtgggcac ctaggttacc aatactggct taatggctac atacggcggt cagtttacgc     47760
     ttacccattc ataaatacgc ggtaatgtta atactacact ctcctccgag taaacagttg     47820
     cgaacttctg ctgtgcgctc atagcagacc ttgcaggtct tccgacggtc cgcttcgtgc     47880
     caggggcaga catagataaa gcatgctctg catgaatcat tgaggagata gtcactcttg     47940
     aaatgtaaat cccctggaat tctcaccatt ccataactgg tatttgtaag ctttagtatg     48000
     atataaatat tattttatgg attttaagaa aaaccaataa aagttctatt ttttttataa     48060
     atggagaaca aagatgaata atggcgaaga taaaaaaaca gctttcttga taaaggatta     48120
     gaaatatcca aacctatcgc aggattattt tcttctgcaa tcggtggcgg tatagcgggg     48180
     tcttcaggag gtatgcctgg agtcgttata ggggcggttg catattacct tgcagatgtt     48240
     agtaatcgag ggttatctcg gattcaagaa aatagagcat taactgcgct aaatatcgca     48300
     tctcgagaaa tcgaaaaaaa ttaacttaca gcagaacagt agagatatgg ctagtgacct     48360
     ctgcgtatag acattttttt taacataacc acacacatat attatatcaa tatattattg     48420
     ttaatcaaag cactgctgag tgcttgcatt gtaatacttt caggtgaata tctgtgccag     48480
     taaagcttca ccttttgctc aaactctgga ctcagattta taattttacc ggaagcaagt     48540
     tcaaagctta tttgttgttt aggtatcata caacatgcca ggtgttgtaa taacattgtg     48600
     acatatgctt ctgaggaaga tacaatatga ctttgtagcg ttcctggcac caacccaaaa     48660
     tattgctgca aaaatttatg atgcatatct gtatcatgat taaaggatac aatcggggcc     48720
     tttaataaat tttcctttga tacgccctgg ctgaaatatc tggaataaaa ctctggtgtt     48780
     gcacaaaaaa tataatcgag agacccaaca taatcacata gcccgccaat gattgcctgc     48840
     ggctgagaac tgatacaacc tacaacctct ccttttaaca gacgcttaag gtttttattt     48900
     tcatcatcca cttttatatc cagtcttata gatggatttt ttaaaaaaac acacaaggca     48960
     ggaattagcc atgttgccag cgtgtcagaa ttcactgcga tcggaatggt cacaatgctt     49020
     ttatttgcat caaggttcaa tacatcatgc tcgaatatat taacatgata tagcagtcct     49080
     gctaatttct gaccataatc agttaaatgt ggaggtgaag tacgagtaat taactgaaca     49140
     ccgcactgat tttcaagttt ttttattttc tgagatattg ccgattgtga aataccaaga     49200
     attcgggccg ctctgtaaaa ccctttttgc ttgataacga gatcaagatt ttttaacaat     49260
     gaataatcaa taaagtttct catttgcata gatatttgac cccggactga tgatcaccat     49320
     cagtccgggt taatattact ttgatgttct catggcagga aacataataa catcgcgaat     49380
     ggtatgacag tttgtaaata acattatcat acgatcaata ccaattccca gacctgcagt     49440
     cggaggcatg ccatattcaa gtgcagtaac gtagtcctcg tcataataca tcgcctcctc     49500
     gtctcctgct tctttggctt ttacctgctc tttgaatcgt tccgcctgat cttccgcatc     49560
     atttaactct gaaaaaccgt tcccaatttc acgtttacca ataaaaaatt caaatcgatc     49620
     tgtatataat ggatttttat cattacgacg agctaatggt gatatttctg ccgggtattc     49680
     agtgataaat gttggctgaa taagatgctg ttcaacaact tcttcaaata tttctgactg     49740
     cagacggccc accccccatg atggttccac agtaattccc aattttcttg ctgtcagaga     49800
     agcactctga atatcatcaa tgtcagtcag tgtaattccg tttccatatt taatgattga     49860
     ttcacgcatg gtgagtttgt taaatggctt accaaaatca aacaattcat cgccatattc     49920
     tataagcgtg gtaccaagaa cattttgagc tactgttctg aataagtctt cagtaaaatt     49980
     aatcaggtca tggaaatctg cataagctat atagagttcc atcattgtaa attcaggatt     50040
     atgacgcgga gatattcctt cgtttctgaa gttacggtta atctcgaaaa cacgttcaaa     50100
     tcctccaaca accagtcttt tcaaatacag ttccggagat attcttaaaa acatgtcctg     50160
     atcaagtgca ttatgatgag taataaaagg ccgtgcggat gcaccaccgg gaatagactg     50220
     catcataggc gtttcaactt ccataaaatc atgttccgcc atgtaacgac gaatttcagt     50280
     caatatccgt gaccgagttt caaatgtacg atatgtatca tgattgacaa tcagatctac     50340
     atatctttgg cggtatctga gttcttggtc aagcaaacca tggaacttgt ctggtaatgg     50400
     tcttaatgat tttgttaaga gagaaatttc ataacaatta acagacaatt catttgtttt     50460
     tgttttaaac agtttacctt taataccaat tatatctcct gtatcaagtt ttttgatatc     50520
     agaaaacgtt gattcgggga gtatatcact ggaacaataa agttgtatac ggcctttatt     50580
     atcctgtata tgcataaata tggatttacc cattatccgt ctggacatta tacgtccagc     50640
     cataatgaca ttaatgtctt ttttagttaa atcttcatga gtcaataatc catactgttc     50700
     agataattca acagaattat gctgccgtct aaagtcattg ggaaatacaa caggcgttcg     50760
     ggcgcgaagt tgtcttaact tttgttttct gacatataac tcatttgttg aatcattggt     50820
     atctgttgac atatttcttc ccctccggtt attttgtttt catactgatt attaccacac     50880
     atctgttaca aagcaagggg gacattataa gcatgatctt ataatcagat tattattatt     50940
     aatttttaat tataacatat gtattctgtg aactagttgt ttcaatcaat tcatctgaaa     51000
     tcgataaaga actgcatgga aagttgaatc aaccaagaaa gatatcacac gaaatcacct     51060
     cgttcaggga ggtgacattt gctataaaaa tgaacaggaa atgctgtgag gagggaacat     51120
     aaatactatt catgtaccgc catacaggag attttattgt gtagatattc tttgatataa     51180
     tctctggggc caatactaaa ctctttctta aaagaataat taaaagagga tgatgaactg     51240
     tagcctaact ctattgcaat tttttttatc ttatcattat tttgtatttt gcttatagct     51300
     ttcaataatt ttatccagtt ataaaattga tataatcctg tcccggtgta cctcctgaaa     51360
     atccgcttaa gatagtcctc ctgtaaataa acacttgcgg ccagttcacg aatcgttgta     51420
     gtattattat tcagcatatt aagaacagtc agtctgactc tgacatcagt attatcatct     51480
     gcgataaaat caatcaactt catctccagt agtgataata taagtgtaac cgatactttc     51540
     ccattaatag atggagtaat atttccaatt gttatttttt ctcctgttat tttaaatatt     51600
     ctgtctattg ttttttttat tgtttttgaa tatgcaaaat agtgcgtatt ttcagaagta     51660
     ttctgaaaag atgtaatttc ttttcttgtc agtgtaacac tataataaat gttattgtca     51720
     tagccaaagt ggtttaaaac tattaaaccc gcatcattaa atcccagttc ttgtggagaa     51780
     tacaataacc gaatatgagg ggaaaggact tcttttataa aagaaaatac tgtcatatac     51840
     aacctcaata tatcttatac taactgtatt tgctatgtaa ctttaacatg cattcagtta     51900
     tcagagatat tctatcaaaa tggtattatt ttacacacgc agatatgcct gttaacaatt     51960
     atttatgttt tacacattaa gctcgacaag cttattgcga gaataacttc ctcacaacaa     52020
     acttgtcgaa tattacagat tattttttaa tgacttttgc agtatacctg ttatccgcct     52080
     ttcgatacag accatgaata tcggtttcaa aaccaggata gtggttacca atttcacaaa     52140
     gcattaacaa aaactccaga accggacgat tgctctctgt aatcatttct ccgggaagaa     52200
     ctaaaggtac tcctggtgga tacggaagaa tcatattagc attaattttc cctaccaagt     52260
     cttcaatgaa acattcctcc gtttcaccac gaagttctgc ctggaaagcc tgctgaggtt     52320
     tcattaccat ttctggcagg acatcgaaag cccggaacat taactccggc agattatgct     52380
     tgcgaatcag attatgaatt ccctgtgcca gctcctgaat tctcatattg ttgtaaaaag     52440
     ctggcgattc ggcccagatc cctggcagaa tatctttgac cagctcatta cgatcgtacc     52500
     gctccttaaa ttcatacaaa ccatgcagaa gactaagagc cttagtatca tcaatcccaa     52560
     tgctgaacag gaacaaaatg ttatatggac ctgttttttc gacaataata ccacgatcat     52620
     ctaggaattt tgaaactaat gctgcgggta taccttgttc ttcaattttc ccgtatttat     52680
     caagacccgg cgtcaataaa gttactttaa tggggtcaag atacatatgt tcttgatcaa     52740
     tatctttgaa tccatgccat tgatcgtttt tatccaatgg ccagcaatct acctcattaa     52800
     tgttctcagg ttgccatact ttaaaaaacc aagtgtcact gttttcaaag cgggcctgga     52860
     tttccttacg aaaagccaga gcacgttcca tggattcctg aataagacgt ttgccaggat     52920
     tgcctttcat catagccgca gccatttcag tggaggcgac aataccgtaa tgaggagagg     52980
     tggaggtttg catcatatag gcttcattaa aggtttcttc attaatatca cctttaacat     53040
     gaatcatgga tgcctgtgaa aaagcggcta acagcttatg cgttgactgc gtttcatata     53100
     ttacttttcc ttcaatacgc ttgccaccca tacccgtttt gccagaataa atcggactga     53160
     aattggtata tggcacccat gcggaatcaa aatgaataga ttttacatcc agatgttctt     53220
     tgatccagtc ggtattataa aacagaccat cataagtaga gttagtgata acggcatgaa     53280
     ctggccatgt tgcacctggc gtaacagcca ttttctgctt aatcgaatca gaagagaatt     53340
     ccgttctggg gatccccccc agaatgccat atgcatttcg tgtaggtttc agatatatcg     53400
     ggatgatgtc actcatcatc aacatatgtg tgagagattt gtggcaattc ctgtcaatca     53460
     gtgcagtaca tcctgcaggt acggagaatt gcccaacaat tttattagct gtcgacgttc     53520
     cgttcgtaac aatatagctt ctgtcagcat taaaagtttc agcaatatac ttttcggctt     53580
     ctgaatgagg tcctgagtga tcaagcagcg accccagttc tccgacagac actgaaatat     53640
     ctgatttcat ggtattttca ccaaaaaaat catagaacaa actacctgca ggcgatttct     53700
     ggtaagctgt tcctcccatg tgtcctggcg tacagaaagt atatttacct tccttcacat     53760
     agttaaataa tgcttttgtt aaaggtggta atattgcatc aatatagtca ttaattattt     53820
     tctggatttt attaacaatt tcgtcaacag aataaaggca acaatcaata agatgtacat     53880
     ttccgtcgaa tgaatcaaaa caaaattttt taatggcaac atcatcggtc ttaagtaaga     53940
     agactggcag atgttcattc agcatgcgaa ttttgtcaag aatatcattc gaatcatcca     54000
     aatccagtaa tactgcagcg attcttgcgt tgtttcttat aatggtttca attttctcac     54060
     tacaaccagc cagttcagtg ccaaaatttt ttgtatgtaa atgagaaatg atttctgcca     54120
     catatttatt gtcaaaagac ttactaccaa tcaatatggt attcatactt taattcctct     54180
     ttttggtctt gttgatttaa atatttttgt gctgaatgcc acccagcttt cttgcgtaga     54240
     aagcgaatat taataatgaa ataataattg ttgcagttat ttcataatgc tctgcaccag     54300
     ccagcgcagc aaaacagaac aacatagcaa acgctgaagc gatcagactc aaaatacttt     54360
     ttgaagttgc actttcaaaa cgaataaggt caatagccga gtaaaaatat gggaacatag     54420
     ttaacaaaac agcaatgctt gttaattgag taaataaatc cgcagcgtta gaaccactgg     54480
     cactgagaat agtcagtaat accatcaaaa tgctcatcat cgttgatgca atgagcaacc     54540
     ctttcttggg tacaccatta ttgtctgttt ctccaaatac agccgggaag ttaccatcca     54600
     ttgctgcacg acgtcctgcc tgtccaacca gcatcatcca ggagcccaga gatgtcagac     54660
     atgcaatagc cgtaaatgcc gatacaaatg gagccgccca gtccccgaca attctggatg     54720
     cacttaaagc aaaaggtgct cctgaatttg ccacgacttc gttcggaaac atgcctgcaa     54780
     taacttggga ggccgcaata taaactattc ctgcaagtgc agttcccccc agcgttgcca     54840
     atggaactgt tcgggaagga ttatggacaa gatctgaact aactgccgca gattcgacac     54900
     caacaaatgc ccacaagcaa agaagaacag aattaataac agcctggtgg acatttccat     54960
     ctggctgagc catccagttc tggcgataaa cttcaatatc gaatgatccc caaccgaata     55020
     atgccgttcc aactacaggt ataagaacaa gcacaagtcc aattgatgtc aaccgactga     55080
     cccatgcccc gcccagcaag ttcacaaacg taaataacca taccatggca atactggtaa     55140
     tcgctgccgg aacaggatta ttcagaacag ggaaaaatac tgataaatat gccactgcag     55200
     taatagctat tgctaaatta ccaatccagt ttgcatgata ataaagaatg gatgtctgat     55260
     gcccgaatat tggagcaact tctccagcat acgcaatagg cccacctgtt tgtgggttat     55320
     tagttgccag acgagcaaaa acatatgcca gagataatgc accaattgcc gcaataatcc     55380
     atccccatat agcgacagaa cctattttcg ccagacttgc aggaagaagc gcaataccac     55440
     ttcccatcat atttccagcg acaactgcaa tacatgttat taatcctatt tttttaggac     55500
     cactcataat tttatcctct ttagccaaag atttattaat aattaacttc ctcaatgaca     55560
     tatttagtat ttacttatag taattcgatg atgtgatatt gatcatgaaa attttattaa     55620
     gcacgaacct ttagttttgc attttagata tagttatata ttctggataa agttcagttt     55680
     tttgttttgt gatgtattta ctcaagaatt tccttatgca taatttcttc gctatgaagc     55740
     atggagcgaa gaatacttat tctgtaatct cttgttttat tccgaagata tgtaagtgtg     55800
     aaacctgcca gcactgcttg ttataccaat ttcttgcaag acaactgaga acctttcaaa     55860
     atcagatgga gttctaatga attcaaactt cgtatggttg aactggcatc acaacccggt     55920
     gcttgtgtgg cccagattgc acgagaaaat ggtctcaatg ataatgttat tttcaaatgg     55980
     ctcagactat ggcggagcga agggcgtgtt tcgcggcgtc ttctggtaac gacttcttct     56040
     gactctggcg ttgaattatt acctgtggag ataactccgg atgagcagaa agtgccaatg     56100
     acggccattg ctccgtcttt atccacttcc actcagacta cagtctgtgc cagctcctgc     56160
     aaggtggagt tccgtcacgg taaaatgacg ctggaaaatc cttcgccaga gctgctcacg     56220
     gtgttgctcc gtgaactgac cgggagggga ggatgatttc actcccatcg ggtacccgca     56280
     tctggctggt tgccggcgtt accgatatac gtaaatcctt caacggatag gacatatgct     56340
     gaaggaggag cagtaatgga ttaagtgatc acagatgccc ggaaatatag attcaaatcc     56400
     agcttagtta atacataaat actattttga tgaaaattat tatatgttac ctcggatttt     56460
     aatcaggccc tcagattaaa ttaaatattg agcgcctgat tatatttatt cattaatatc     56520
     tgtcattgat tgtcttacta tcaattaccc tccgtattaa tcagagtttt catttatttt     56580
     tagtgcataa tcagatgccg cttcatcatt atcctcactg ttatcatagc cgaaaacttc     56640
     ccccggacac gggcgttcac gataatagtc atcgtcatag ttttcatcgt cagataatga     56700
     tatgtcgtat tctgaatatg attcaccaca attatacata aaatcatctc ctttgggatg     56760
     gttacaataa ttagtgagtt tattcgaaaa aataatgagc gccagaccaa tccacccgac     56820
     ttttgattat aatcatgaag atacctgtct cagtacaaat agaatcaaac tcagtgcagc     56880
     atgattcacc tttatattct ctcagggaaa ccaaatacca ctactcaact attaagaaca     56940
     aaattctgga ggtatgatta tctgaagata cctgcatcct aaataatttc agacagatat     57000
     tatctccgtg aatcccccgc cacctttccg gtgcgcgggg ttttgtcttt tttcaccggg     57060
     aatatatgta tgaatccgtc tgatgccatt gaggcaattg aaaaaccgct ctcctccctg     57120
     ccttactcac tttcccgtca catcctggaa catctgcgca aactcaccag ccacgaaccc     57180
     gtgattggca ttatgggtaa aagcggggcc ggtaaatcct cactctgtaa tgcactgttt     57240
     cagggggagg tcaccccggt cagtgatgtt cacgccggca cccgggaagt gcagcgcttc     57300
     cgtctgagtg gccatggtca cagcatggtt atcactgacc tgcccggggt gggagagagc     57360
     cgggacaggg atgcagagta tgaagccctg taccgtgaca ttctgcctga gctggacctg     57420
     gtactgtggc tgattaaagc cgatgaccgt gccctgtctg tggatgagta tttctggcga     57480
     cacatactgc aacgcggaca tcagcaggtg ctgtttgtgg tgacgcaggc cgataaaacg     57540
     gagccctgcc atgaatggga tgtggccggc attcagcctt ctcccgcaca ggcacagaac     57600
     attcgggaga aaacggaggc ggtattccgt ctgttccggc ccgtacatcc ggttgttgcc     57660
     gtatcggccc gcaccggctg ggaactggat acgctggtca gtgcgctcat gacagcgctt     57720
     cccgaccatg ccgccagtcc cctgatgacc cgcctgcagg acgagctgcg cacggaatct     57780
     gtccgcgctc aggcccgtga gcagtttacc ggtgcggtgg acaggatatt tgacacagcg     57840
     gagagcgtct gtgttgcctc tgttgcacgc acggttctgc gtgccgtccg tgacacagtg     57900
     ggctctgttg cccgcgcggt atggaactgg atcttcttct gaacctgttg tggatgatgt     57960
     ccttcctgcc tctgagtctg ctcacaaaag cgctgttttc gttactgtct ctcttgtccg     58020
     tgcaatagct tgataataga ataaaacgat cgatacctat ttcaccgatc gttaatatcg     58080
     atcgttatgc taataataac tcatgttagc aacgtgcgca gatacacaca gtcatgagat     58140
     tcagggaaca acagagccac acgtcagaaa cttccgtcag ccggacctcc ggcactgtaa     58200
     ccctttacct gccggtatcc acatctgtgg ataccggctt ttttattcac cctcactctg     58260
     attaaggaaa tgctgatgaa acgacatctg aatacctgct acaggctggt atggaatcac     58320
     attacgggcg ctttcgtggt tgcctccgaa ctggcccgcg cacggggtaa acgtggcggt     58380
     gtggcggttg cactgtctct tgccgcggtc acgtcactcc cggtgctggc tgctgacatc     58440
     gttgtgcacc cgggtgaaac agtgaatggc ggaacactgg taaaccatga caaccagttt     58500
     gtatccggaa cagctgatgg cgtgactgtc agtaccgggc ttgagctggg gccggacagt     58560
     gacgaaaaca ccggcgggca atggataaaa gcgggtggca caggcagaaa caccactgtc     58620
     accgcaaatg gtcgtcagat tgtgcaggca ggaggaactg ccagtgatac ggttattcgt     58680
     gatggcggag ggcagagcct taacggactg gcggtgaaca ccacgctgga taacagaggt     58740
     gagcagtggg tacacggggg agggaaagct gccggtacaa ttattaacca ggatggttac     58800
     cagaccataa aacatggcgg actggcaacc ggaaccatcg tcaacaccgg tgcagaaggt     58860
     ggtccggagt ctgaaaatgt gtccactggt cagatggtcg gggggactgc tgaatccacc     58920
     accatcaaca acaatggccg acaggttatc tggtcttcgg gggtatcccg ggacactctc     58980
     atttacacag gcggtgacca gacggtacac ggagaggcac ataacacccg gctggaggga     59040
     ggaaaccagt atgtgcacaa atacggactt gcgctgaaca cggtaattaa cgaggggggc     59100
     tggcaggttg ttaaggcagg tggtactgcc ggcaacacca ccataaatca gaacggcgag     59160
     ctgaaggttc atgccggcgg agaagcgtct gatgtcaccc agaacacggg aggtgcactg     59220
     gttaccagca cagcagcaac cgtcaccggt acaaaccgcc tgggagcatt ctccgttgtg     59280
     gagggtaagg ctgataatgt cgtactggaa aatggtggac gtctggatgt gctgagcgga     59340
     cacacagcca ctaatacccg cgtggatgat ggcggaacgc tggatgtccg caatggtggt     59400
     accgccacca ccgtatccat ggggaatggc ggggtactgc tggccgattc cggggccgct     59460
     gtcagtggta cccggagcga cggaacggca ttccgtatcg ggggcggtca ggcggatgcc     59520
     ctgatgctgg aaaaaggcag ttcattcacg ctgaacgccg gtgatacggc cacggatacc     59580
     acggtaaatg gcggactgtt cactgccaga gggggctcgc tggcgggcac caccacgctg     59640
     aataacggcg ccatacttac cctttccggg aagacggtga acaacgatac cctgaccatc     59700
     cgtgaaggcg atgcactcct gcagggaggc tctctcaccg gtaacggcag cgtggaaaaa     59760
     tcaggaagtg gcacactcac tgtcagcaac accacactca cccagaaagc cgtcaacctg     59820
     aatgaaggca cgctgacgct gaacgacagt accgtcacca cggatgtcat tgctcagcgc     59880
     ggtacagccc tgaagctgac cggcagcact gtgctgaacg gtgccattga ccccacgaat     59940
     gtcactctcg cctccggtgc cacctggaat atccccgata acgccacggt gcagtcggtg     60000
     gtggatgacc tcagccatgc cggacagatt catttcacct ccacccgcac agggaagttc     60060
     gtaccggcaa ccctgaaagt gaaaaacctg aacggacaga atggcaccat cagcctgcgt     60120
     gtacgcccgg atatggcaca gaacaatgct gacagactgg tcattgacgg cggcagggca     60180
     accggaaaaa ccatcctgaa cctggtgaac gccggcaaca gtgcgtcggg gctggcgacc     60240
     agcggtaagg gtattcaggt ggttgaagcc attaacggtg ccaccacgga ggaaggggcc     60300
     tttgtccagg ggaacaggct gcaggccggt gcctttaact actccctcaa ccgggacagt     60360
     gatgagagct ggtatctgcg cagtgaaaat gcttatcgtg cagaagtccc cctgtatgcc     60420
     tccatgctga cacaggcaat ggactatgac cggattctgg caggctcccg cagccatcag     60480
     accggtgtaa acgttaaaaa taacagcgtc cgtctcagca ttcagggcgg tcatctcggt     60540
     cacgataaca acggcggtat tgcccgtggg gccacgccgg aaagcagcgg cagctatggc     60600
     ttcgtccgtc tggaggggga cctgctgaga acagaggttg ccggtatgtc tgtgaccgcg     60660
     ggggtatatg gcgctgcagg ccattcttcc gttgatgtta aggatgatga cggctcccgt     60720
     gccggcacgg tccgggatga tgccggcagc ctgggcggat acctgaatct gacacacacg     60780
     tcctccggcc tgtgggctga cattgtggcc cagggaaccc gccacagcat gaaagcgtca     60840
     tcggacaata acgacttccg cgcccggggc tggggctggc tgggctcact ggaaaccggt     60900
     ctgcccttca gtatcactga caatctgatg ctggagccac aactgcagta cacctggcag     60960
     ggactctccc tggatgacgg ccaggataac gccggttatg tgaagttcgg gcatggcagt     61020
     gcacaacatg tgcgtgccgg tttccgtctg ggcagtcaca gcgatatgac ctttggtgaa     61080
     ggcacctcat cccgtgacac cctgcgtgac agtgcaaaac acagtgtgcg tgaactgccg     61140
     gtgaactggt gggtacagcc ttccgttatc cgcaccttca gctcccgggg tgacatgagc     61200
     atggggacag ccgcagccgg cagtaacatg acgttctcac cgtcacagaa tggcacgtca     61260
     ctggacctgc aggccggact ggaagcccgt gtccgggaaa atatcaccct gggcgttcag     61320
     gccggttatg cccacagcgt cagcggcagc agcgctgaag gctataacgg tcaggccacg     61380
     ctgaatgtga ctttctgata atcaggtcac tccccttcag gccccggtca tcatgaccgg     61440
     ggctttttac tttcagggag caacagatat gccgggttgt acagcacgtt tattgccgaa     61500
     ggctcttttg ctgccaaatg gcatctgaat agatcacagt ctggccggtt attacccgat     61560
     cccgatgggg ttattgggtg atctccttcc ataaaaatac gcagctcgcc agtgaagggc     61620
     ttctcagaca ataaacgtca ttcatttccc ccatcaggcc gcgtcttctc cgggagacgc     61680
     ggctttttca tttataccgc taactcattc ataaggaata aatcatgcga ttagccagtc     61740
     gttttggtta tgcgaaccag gtacgtcgtg atcgtccgct gacacacgaa gaactgatgc     61800
     gccatgtacc gagtattttt ggggaagacc gacatacctc ccgcagtgaa cactatgcgt     61860
     acattcccac tatcaccgtc ctggaaaatc tgcagcagga aggctttcag ccattcttcg     61920
     cctgccagac ccgcgtacgt gacccgggcc gccggggata cacaaaacac atgctgcgcc     61980
     tgcgccgtaa cggggagata aacggacaac atgtccctga aattattctg ctcaactccc     62040
     atgacggtac ctccagctac cagatgctgc cgggttactt cagattcgtc tgccagaacg     62100
     gctgcgtctg cggtcagtct ctgggggaag tccatgtgcc ccaccgggga aatgtggtgg     62160
     acagagtcat tgaaggggct cacgaggtag tgggcgtttt tgaccggatt gaggaaaagc     62220
     gtgatgccat gcagtctctg gttctgccgc caccggcacg tcaggcactg gcacaggcgg     62280
     cgctgactta ccgttatggt gatgaacatc aacccgtcac cactgccgac attctgacac     62340
     cacgacgccg ggaggattac ggtaaggacc tgtggagcgc atatcagacc atccaggaga     62400
     atatgctgaa aggcgggatt tccggccgta gtgcaaaagg aaaacgtatc catacccgcg     62460
     ccattcacag tatcgacacc gacatcaagc tcaatcgcgc attgtgggtg atggcggaaa     62520
     cgctgctgga gagcatgcgc tgatgttgtt tccctgaaag tgcaaccctg actcacgtct     62580
     gtatcagtcc ccaggcattc ttccattcat ttgcttttta taaggaatag tctcatgaca     62640
     acctcttcgc ataattccac cacaccttct gtttccgtaa caactgcatc agggaataac     62700
     cagtctcaac tggttgccac tcctgtccct gatgaacagc gcatcagttt ctggccgcag     62760
     cattttggcc tcattccaca gtgggtgacc ctggagcccc gtgtcttcgg ctggatggac     62820
     cgtctgtgcg aagactactg cggtggtatc tggaatctgt acaccctgaa caacggcggg     62880
     gcatttatgg cccctgaacc ggatggcgat gatgacgaaa catgggtact gttcaatgcc     62940
     atgaacggta accgcgctga aatgagcccg gaagccgccg gcattgccgc ctgtctgatg     63000
     acgtacagcc atcacgcctg ccgtacggag tgttatgtca tgacggttca ttattaccgt     63060
     ctgcgggatt acgccctgca gcatccggaa tgcagcgcca ttatgcgcat cattgactga     63120
     aagggggccg gaacaatgca acagatttcc tttctgcccg gagaaatgac aaccagagag     63180
     cgcagcctca ttcagcgggc cctgaaagcc ctggaccgcc atcttcatga acccggcgtg     63240
     gccttcacct ccacccgtgc ggcacgggaa tggctgattc tgaacatggc gggactggag     63300
     cgtgaagaat tccgggtgct gtatctgaat aaccagaatc agctgattgc cggtgaaacc     63360
     ctcttcaccg gcaccatcaa ccgcacggaa gtccatcccc gggaggtgat taaacgcgcc     63420
     ctgtaccaca atgccgctgc cgtggtgctg gcacacaatc acccgtccgg tgaagtcaca     63480
     cccagcaagg cagaccgcct tatcacggaa cgtctggtac aggcactggg cctggtggat     63540
     atccgggtac cggaccatct gatagtcggt ggcagccagg ttttctcctt tgcggaacac     63600
     ggcctgcttt aacccgtcac cgtcacaacc acatcacacc tgttttcact tttatcttct     63660
     gtcttcagag gtatcccatc atgaaaatca tcacccgtgg tgaagccatg cgtattcacc     63720
     gtcagcatcc ggcatcccgt cttttcccgt tctgtaccgg caaataccgc tggcacggca     63780
     gcactgaagc gtataccggt cgtgaagtgc aggatattcc cggtgtgctg gccgtgtttg     63840
     ctgaacgtcg taaggacagt tttggcccgt atgtccggct gatgagcgtc accctgaact     63900
     gatgttccgt cacccggaaa acgagtacga ctggctgagc tcagacgccg ctgtggatga     63960
     ggccctgctc ataaacgaat acacctttac cgaaggcggt ctgcgcgccg gctgacctgt     64020
     catcgttaaa ccattcttaa ccgattttct gtgaggattt tatcgtgtca gacgcactct     64080
     ccgggacaat gcttcccgac gacaatcacg accgcccctg gtgggggctg ccctgcaccg     64140
     tgacgccctg tttcggggca cgtctggtgc aggagggtaa ccgcctgcat taccttgccg     64200
     accgcgccgg tatcagaggc ctgttcagcg atgcagatgc gtaccacctg gaccaggcct     64260
     ttccgctgct gatgaaacaa ctggaactca tgctcaccag cggtgaactg aatccccgcc     64320
     atcagcatac cgtcacgctg tatgcaaaag gtctgacctg caaagctgac actctcggta     64380
     gcggtggtta cgtttatctg gctgtttatc cgacgcccga aacgaaaaag taaaccaccg     64440
     gaataatcgt ctgttccggc ccggtgcatt acagcaccac tcttcccaca atttactctc     64500
     tcatatcagg aatatcttca gtatgaaaac attacccgac acacacgtac gggaggcatc     64560
     gcgctgcctg tctccggttg aaatctggca gacactgctc acccggttac tggaccagca     64620
     ctacggcctc acactgaatg acacaccgtt cgctgatgaa cgtgtgattg agcagcatat     64680
     tgaagcaggg atttcactgt gtgacgcggt gaactttctc gttgaaaaat acgccctggt     64740
     gcgtaccgac cagccgggat tcagcccctg tacccgctct cagttaatca acagtatcga     64800
     tatcctccgg gcacgccggg caaccggcct gatgacccgc gataactaca gaacggtaaa     64860
     taacattacc cggggtaagc atccggaggc gaaacaatga aactggccct gacgccggaa     64920
     gccgatagca ttaacgtgca ggcactgaac atggggcgca ttgtcgttga cgtcgatggt     64980
     gttactctcg ctgaactgat taacgtggtc tgtgataatg gccactccct tcgtattgtt     65040
     gatgaatctg accgggcctc aacagactgc atgccaccat ttgctgccct taccggtata     65100
     cgctgcagta ccgcacatat cacggaaacg gacaacgcct ggctgtactc gctgtcacac     65160
     cagactaatg acgacggcga atcagaatgg attcatttta ccggcagcgg ctatctgtta     65220
     cgtactgata cgtggccgta tccggttctg cggcttaaac gactgggcct gtccagaacg     65280
     ttccgccgtc tggttgtcac tctcatccgc cgttatggcg tcagtctcat tcatctggat     65340
     gccagtgcca gatgcctgcc gggtttaccc actttcaact ggtaaccagg aacaacatga     65400
     aatcattaac cacggaaacc gcactggata ttctgattgc gtggctgcag gacaatatcg     65460
     actgcgaatc ggggattatc ttcgacaacg atgaggataa aacggattcg gcagcactgc     65520
     tgccctgtat tgaacaggcc agggaagata tccgtaccct gcaccagttg cagtttctgc     65580
     aacagaactg gtgagtctta ctcaccagac ttcattccac tgacgccagc ctgaacaggg     65640
     ctggcgtttt catttatctg caaaaaggaa tatcgattat atctgaactc acagcctccc     65700
     gtccggaagt ggtcaacgga catacggacg ttatcggctc aaccagtatc cgccacattc     65760
     tggctgtacg acagagtaca ttgctgcaaa tcgacacact tatccggcaa ctggctgaaa     65820
     tctcagcaat gacagtaagt attggcggta aaactgcact ggactgggcc atgaaacagg     65880
     attttcgctg cggtttctgg ctgatggaga aacctgaaat cgcaatgaaa gccatcaccc     65940
     ggaatctcga tcgcgaactc tggcgtgacc tgatgcaacg ttccgggatg ctttccttaa     66000
     tggatgcaca ggcccgtgag acatggtacc ggtcactgga gtacgataat gtcccggaaa     66060
     tcagtgaagc aaacattctg aacacattta aacaactgca ccagaataag gatgaggtgt     66120
     ttgagcgagg ggtgatcaac gtcttcaggg gactgaactg gaattacaaa accaatttac     66180
     cctgcaaatt tggcagtaaa attatcgtca acaatctggt gagatgggac cggtggggat     66240
     ttcatattgt caccggacag caggctgacc gggttgctga cctggaaagg atgctgcacc     66300
     tgttcagcgg ctggcccatc cccgacaacc gggaaaatat catcatccgt ctggatgacc     66360
     acattcagtc cgctcagggt caggagtgct atgaatatga agatgagatg ttcagcatca     66420
     gatactttaa gaagggctcc gcgcacatca cgttcagaaa accggaactg attgatcggc     66480
     taaatgacat cattgcgaag tattatccag aaataatccc atacaatatc taataaaact     66540
     aatcatttct tgttgtgact gatttagttg aaccatactg catggtcgag tagacagggt     66600
     atctcagacc atgcatgtat ttttatcatc tgttcccaaa ttttatatga ataacattat     66660
     ccggagcatt ctgctgcaca gtaatgacgt tattcataat aaaattcccc cattctataa     66720
     ataaattttt taatttttca gcttgttgtc cgacttgata tgttcgtatt aaacggtctt     66780
     tgggtacatg atttaacagt aactctatta ggcgctctgg agcatcaagg tattcagcgc     66840
     atccagtcgc aacacttcta cgcagatcat gaggagaaaa tggagtaagt tcggctagat     66900
     acttagagcg aaccctttct aacgcgcgag tcagagcgtc atttgtgatg ggaaagtcag     66960
     gtttgctagt agaaccaaaa acatatgcac cttcagtgaa ttcacgttgt gtttttatta     67020
     aagaaagcat atacggatgt aaagtaacaa tatggctttt cccattttta gtggctggta     67080
     tggtccaacg ctctccatta atttgatccc agcgcatttg tgccgcttca gagcggcgca     67140
     ctcctgtgaa aataatcaaa cggagtgcat ttgcgacaga atgagataat accacactag     67200
     aggaaattcc atagccacca gatgcaatgg agcctcctcc aacagtagca tcatccaaag     67260
     ccttccatag catccggagt tcattctcag gaagccatcg ctcgcgaggt ttattcatcg     67320
     atgcaccaaa cattgctggt ttgagcagtc gtgctgggtt atgctcaagc ataccctgta     67380
     agttggcatg atcaagagtc atatttagaa taattaatcc tttacgaact gcttcagaac     67440
     tggtttttct tacattactg agatgttcaa aaataacgct tttggtaagt tcgtcaatgc     67500
     gaaggtttcc taatgctttt tcaaggtggc ggtgataagt cccttcataa tctgcaaggg     67560
     ttctggtgct aattggtttg cttgtctttc tgaattctat ccaatctttc cataattcag     67620
     agtaaataat catttgttca tttttttgtt tttcattttt tctaatatga cgaggatcta     67680
     taccttttct tactaattca attgcatccg catgagcttt acgagcttga gctaatccca     67740
     tggcagggta actacctagt gttaatttag ctggcttttg agctattcga taacgataaa     67800
     tccagctttt attgtcgcta ccataacgaa cgcgtataaa gagtcctccc ccagctttag     67860
     attttacagc aaataagatt tctttttctt ctttagtaac ggtcaatgaa gccaattgtc     67920
     tgtcttgtgt aatagtaaaa gtcatatctt cagccttttg ggtacacagc ggggtacaca     67980
     tttaacatga tatcatcaga aacaaggcga aacatcttga tactgcattt gtgtgtattt     68040
     tattgatttt tatatatttt ttattgtatg ttgaaacggc tgtgaacatc ttgaatcact     68100
     ggtctcgcta attcgtaatg cgaaggtcgt aggttcgact cctattatcg gcaccattct     68160
     aacgtctccc caagtctact caagtattta aaaacctctt ataatcagta tattaatgcc     68220
     ccttttagtc ttttgacgtc tatttaagta ccccaaactc tacaagcaat tgaggggatt     68280
     tgctgttcag tttagtggag atacccccaa gtgaaactca atgcccgtca aatagacact     68340
     gccaagccaa aagagaaggc ttacaagttg gctgatggtg gtggtctgta cctcctggta     68400
     aaacctggtg gaggagaata ttggcgtctc aagtatcgtg tagctggtaa agagaagctg     68460
     ttagcactag gtgtgtatcc tgaggtcacc ttagctgatg ctcctgcaaa acttgaagaa     68520
     gctaaaagag gtatctctgg gggaatcgat ctgatggaag tgaagcgaga ggaaaagatt     68580
     gcccgggaaa cgcagttaaa caacaccttc aaagatattg cccttgagtg gcacagtaac     68640
     aaattataat cacaataata gtgtatataa ttatacattg tatgcttggt aatcatataa     68700
     tgataaaagc ttccgataat cagtatgaga tttgtcctta aactcctgga catgcttttc     68760
     taaatcttcc aatggtatat gtccatttat acaaataaaa ttctagtgat aaataccttc     68820
     aggtatgatt agacaacatc tttattcgat gggggttaat ctatatttga tatctttctt     68880
     ttaaataaca acgccattaa aaacgctttg tttaatgacg tttttttatt gtttcctgta     68940
     taaagcctaa ccagcataaa cattggtggc tcttatgctc attgtaatta aatgagagtg     69000
     tgattaatgt ctttatatat tcaggtagtt attctctcca gaagaataca ttgtaagaag     69060
     atgactgtta gtatgtttta acatcaatta acattaaggt ttgataataa ttttttgttg     69120
     gcgagttcaa atgttttcat ttcatcatct gatagcccgc tccagatttt ctttagcatt     69180
     acattttgag tgtttattag tttttgagca agtgtaactc cgtcaggggt taagcaaata     69240
     cttttgcttc gacgatcgtt tttattatta attcttttgg caatattctt tttttctaat     69300
     ttgtctatga tgtgtgtgat gtttgttttg gagaattgta actccttgta aatatcagaa     69360
     ggggactgac aataatcatc agacatatat aatgaaacta acaccataaa tgttgaagtg     69420
     tttattctat actcgctcaa ttcattttct ataatactct ggattttgtc atttactcta     69480
     atatataagt gtattaacag actctcctga gccgggtatg ccggattttt gatttttttg     69540
     tagtttgtta tagtttttaa taaatctata ttattcataa ttccaccaca cggcaaaaga     69600
     aaactcatga agattactca acctgagtgt tacatgaagt atcgtgaacg ccggaaaatc     69660
     taagttccag cctgtaccgt aatcagataa tcgcagcaaa gggacaaagc aatagtccct     69720
     ttgctgcaca gcatcagaat gaataacgaa tgttagcgtt tatcgcatca tctgtgttgt     69780
     atttaccgaa tgcagagcgt tcaacttcca gccccagacg cgtattgtcg ccaaaccggg     69840
     catttaaccc cacaccgtaa agcatacgac cgtcttttct cccattaatc tgatgttctc     69900
     ccgctgcatc cttcaggtga acgtcagcac tgtccgtcag atcgaactca taatgtaggc     69960
     cggcacgggc tgtcagactc cagtccttac cactgaaggt tttaccggaa acaacgccgg     70020
     ttctgcctac cagaggatta acgctgttac gacgcattga gacatccatt ccactgtcgt     70080
     tccagttaaa tgtttggccc tgcagtcttc cccagaccag ttccgcctga ggttcaacaa     70140
     acgtcgtatc tgtcagatga taacggtatc cgacttctgc acctgcatac agtgaatggc     70200
     tgcggaagtt ctgtttacca gctccggcaa agttcaggtc atatttgttt tcattgtgaa     70260
     tatatttggc aatcaaatca aagtaagcgc cggaccggaa cagaccactg gcatagaaac     70320
     caccacccca tgattttgtt ttaccgctgt acaggcctgc tgacgcatct gtgtcagtgt     70380
     aggtggccat cacgccggta aacaggtcca tacttcccag ttcgtgctta cggtcagccc     70440
     ccatctgcag cagggtatag tggtcagtga aaccgccatc agcagagccg gaaccgttca     70500
     gcagacgcac ccacgtaccg gcttcgccgt taatatccct caaatcgccc atgcgtttgt     70560
     tcaggttgtt aacttcagtg atgaagttgt tatagctgat gtgcatgaat gtggcggcag     70620
     ccttaccctg gccgtcgtta cgtgcaacct ggtaaccatc gaggacccac tcttttttcc     70680
     cgtcctcttt tctgacacta agggtggggg tgacatcact gaatcccaca acccgtgttg     70740
     atgccctgaa cagattatca gctgtcgctt caggtgcgct gaccagtgga atatcaagcg     70800
     tgtccttgtc agagggtttt ttcaggaagt taacccagat gctgttgtca tgacctgttg     70860
     ccgacttgtt tatcaccagt ttgtctgcct tgttaaggtc tgtacgcatg acaaatgctg     70920
     actgaaccgc gtccagatta tctgttgtca gtgtcgtgaa cgatgatgtt cccccgttaa     70980
     aaccgactat tgtccggtta agtttcatat ttcctgccgt ggagtttccg ttcatcgacc     71040
     actgggtgtc tgtcatgctg acggtggcat ccggtgcatt caggctcccg ctccaggtat     71100
     tgcggtaccc gttaaacagg ctgtacaaca tctgattctg aagagtcagg tcaggactca     71160
     gttccccttc ccctccgagg gtgacagtcc ctttatcctg aacattgata ttacctgaca     71220
     acatactgta cggccccacg ttcaggcggg catcgtctcc cttcaggttc catgaaccgg     71280
     cataatcgta tacaggtaaa agtgtgtgag atacctcatc aggacggctg ttcagactca     71340
     gggtggcatc agaaatattc actggaccgt cagaaacaaa actctgactg gccagagcat     71400
     ttgctccctt gttcagattc agggcggtac tggtcagcgt tgagttcccc agaatggcac     71460
     tgtctgagga gatattcacg gtactgttgt tcgcctgtat tccgccattg aatatatcat     71520
     tgatattcag cactgactga ttatccaggt tgacggtgcc gttgaagaca cttttatctg     71580
     catctttagt tgcaacagat gtgccttctt caagggtaaa ggctgttccc tggccatctt     71640
     ttttgtcgat aaatacccga ctgtcgccca gcgtgacgct ggagttatct gcctggatgg     71700
     ttgtgttcag tgtggcattg cggcccagac caaagtctgt atcttttaac acgagcgaac     71760
     caaagctgaa cgtcctgttc tcccagtcat cctgtgtaaa tgaggtgggc tgtgtcagaa     71820
     cggaattgtc gcccagagac gagactgtat ttgcaatact ctgagacgtt gaagcatgga     71880
     taaccgggtg gccctgaatg gtcagacgac cgttttcctg agtaaatgta ccggacatat     71940
     tcgctgagcc gtccataacc aatgcgccgg ttgtacccgg ggttgcttta tttgagaaat     72000
     taatatttcc cagcaacttg ccatgataca gatacccttt attattaatt ctgtttgcaa     72060
     gcagcgcctg tgcactgttc tggtcatgtc cgacatattc ccagtgctcg ttactgacct     72120
     gaccggtagg gaaccagcca taactacttg ttttcaggat aaaataatcg acggtatgag     72180
     tatagggatt attataaata tataatgaac ctactgttcc cctgtttgat gatgaccatt     72240
     cattaacttt tacgtctgcc ggatgcgtct gataatccag agtgatatta gccgttttat     72300
     cactgctgtt accgagagtt gcgccataat cggcggcatt cagcttatga aatgtcaggt     72360
     cattcccgtt aacatccaga acaccccccc ggtagcccca ggatatattg tccggattaa     72420
     cctgctggtt gtctgccagc acgactgtcg ggcggccgct ggcaatattc acgctactga     72480
     atgcctgaac gtgtcctgaa ctgtcagcct gctgattgag gacaacggtc ccatccccga     72540
     ctttcaggcc gccctcatta acaccggttc cctgtacaac cagggttcct tcgccgattt     72600
     tatgcaggtt gtcacctttc acaccattaa cctgccagtt tacggaggca tccttgtcca     72660
     caataatacc ggccccggtc caggtacttc cgtttgaagt ggtgacagtg tagtcatcag     72720
     taaatgtcag tgaaccggca ccctgcgtga cagagttttc caggtcaatc tgaccattat     72780
     gtcccaggaa tgtcagattt ttacctgcgt tcaggtcaga acctttttgc ccgtgcatgg     72840
     catattcatc ggaaccctgt ttcagagagc cagtgccggt gctgctgtca aatttccatt     72900
     gcaggggggc gccggatgag gcattaaaaa agacgggagc gtcattatcc tctgaataga     72960
     tctgtgagag aaaactctga ggaataagag aatatatcaa attggtcccc cctcctactc     73020
     ccgagtaaac accgaccagt tcccactgcc ctttggccgt attccagcca aataatggag     73080
     aaccactgtc gccggcctct ccaaaagagg gcaggatgct atgatcatgt atgttgcccc     73140
     ccatatacag ctgaatgccg tctgagccgt gataaaagaa tgatgtcggg agtattcctc     73200
     ctgtcagata accataccca cctgttaccc aatgtcgctt accctgacta tcctgaatat     73260
     actgacttcc cgaaccagcc ctgtagaatg ccgagtattt tgaaggggtc aatatatcag     73320
     ctgttgatga gctggttacg gtagccggag caacctcagt tacgagctta tcaagtcttg     73380
     gtgtgtggag atcagatgaa ctgtgttcat tacgatccac aatatggtaa ctgttctgac     73440
     catcaccgaa gctgacgctc tgatatcctt tattatgttt tacactggct atatattgcg     73500
     ggttaattaa tgttgcaacg ccgggatttg agcttacatt cacactgcta aaatcaacca     73560
     tgggcgcttt atcaagatgt cctactaatt cccctttatt attaaaaata ggaatgtttg     73620
     ttgcgccagc ctgaaactgc cctttgtttt ctgcaaagtc gcggtatgtc tggtaaggat     73680
     tgttgccacc aaccgttgat gcaccagcaa cggttgggag taatgcagat agtgccagag     73740
     aggtaagtac tgaaagtctt tttcctctgc gggtactccc tttacatacc cttcgggcta     73800
     gttcagagac aacctttact gtgttagtaa tataacaata ttttagagcg tatattttat     73860
     tcatagtaaa tgattccgga acgtatattc caaagttaca ttaataacca tagacaattt     73920
     caaacgaaag cattgttgaa ttgcgcgcta attattaatt agctatataa ttataaatgt     73980
     gacatatgtc acatttattt ttgcttaaaa ctacaatatt ttgtagttgc acgcattctt     74040
     tgtctgtggt tttcattggt ggtaatgaaa atgttgtttg ctttttctca ggtgttttga     74100
     cttatgactt aaagtcataa aatatgcgac gctaatacaa ctacagaaaa atggtatata     74160
     tggatatcga cgatatttgt tgatttttat tttaaattgc gtggcggttc agagcggata     74220
     tatatatcac cataccatca tctgtttttc tgaagttcag attagtttta acacactgtt     74280
     ttccatcttc gttgattaca acagtctttt taatgtattt acgaatggca tcattcgacg     74340
     ttctaacgga tttagtcgat ggtggggtaa ttaataaaac atttgctgta atcaaaaacg     74400
     gtaatgtctt caattgatag aagtttctgg taatctactg gtatttaagg ttttccatgg     74460
     ctaccgttac tgttcatcgt ccgcgctgta attccgataa agtttatcga catggtcgta     74520
     gttgttccca gcatgagcgt ttccgttgtc gttcatgtaa acgtgttttc cagctcactt     74580
     actcttatga agccagaaaa cccggcttta aggagctgat cgttgaaatg gcgcataatg     74640
     gcacaggggc cgtgatatcg ccagaacact gaaaatcagc atcaataccg tcatacggac     74700
     attaaaaagc tctcgcccca gcggataaca tctgcgtcag tcagctcacg ctgatgttgc     74760
     ccttatctgt gaacttgatg agctgtggag cttcgttggc aacaaggcgc aacaacactg     74820
     gctctggtat gcgtagaaca ctaaaactgg cggtgtgttg gcttacactt tcgggccacg     74880
     gaatgatgag gcctgtcggg aattgttagc cctgttgact ccgttctgta tcggcatggt     74940
     ggccgcgatg actggggcag ctacgccaga gaagtgccga aggagaaata cctgaccggc     75000
     aaaatcttca cgcaacgtat tgaacgtaac aacctgaccc tccgcacccg catcaagcgg     75060
     ctggtaagta aaacaatctg cttctcgcgt tccgttgaaa tccacgaaaa agtcatcggt     75120
     tccttcattg aaaagcacat gttctactga ttggaagcac tacccaacgt tcaacttatc     75180
     atcataagta taaaaatcac aaaatgggag gtaagagtct ttacctggat tgtctcgaaa     75240
     tgcaaagtgt gcttgcttta caactaaatc tgggggtatc taatgattgc gtaatagttt     75300
     ttttatatac atatcaatgt cttgcttttt acaatctgtt tatattatcc attttaaatc     75360
     aataggttac acatcgttaa taccttcctt attttttgat tgggacagat ttgggaccga     75420
     tgggttcagg atcgaatcta tttaccgtgc gtgttcggta aggtgattag gtgcgagatg     75480
     agcatatcga cgaaccattt cgagagtttc ctatccgctc atttttaagt gcaagcaggg     75540
     aaacaccgga ccaaaccaat cagctgttcg aaaatggcaa gcggattaat atgccatggc     75600
     ggctttaagc cgcacgcatg gggtgtggca agcctgatgg atgttactgt gcttgtggtg     75660
     gcgtctttgc tggtctggtt gttggttaat cgcgaaaatc attatgccag aggaatacca     75720
     caggacgttc aggttttgca taaaaaagcc caccattaag gtgggcaaaa ggaatgattt     75780
     atattctctg agagaaacat tacatttctc ct                                   75812
//

If you have problems or comments...

PBIL Back to PBIL home page