(data stored in SCRATCH zone)

EMBL: X17430

ID   X17430; SV 1; linear; genomic DNA; STD; PRO; 1170 BP.
XX
AC   X17430;
XX
DT   09-DEC-1991 (Rel. 30, Created)
DT   08-OCT-1999 (Rel. 61, Last updated, Version 5)
XX
DE   B.subtilis DNA for cdd gene encoding cytidine/deoxycytidine deaminase
XX
KW   cdd gene.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1170
RX   DOI; 10.1007/BF00334391.
RX   PUBMED; 2526291.
RA   Song B.H., Neuhard J.;
RT   "Chromosomal location, cloning and nucleotide sequence of the Bacillus
RT   subtilis cdd gene encoding cytidine/deoxycytidine deaminase";
RL   Mol. Gen. Genet. 216(2-3):462-468(1989).
XX
DR   MD5; ba1f0478f1b4be2af79bd6399cefb722.
DR   EuropePMC; PMC229258; 14557635.
DR   EuropePMC; PMC368810; 14694102.
DR   GOA; P42182.
DR   InterPro; IPR004044; KH_dom_type_2.
DR   InterPro; IPR005225; Small_GTP-bd_dom.
DR   InterPro; IPR005662; GTP-bd_Era.
DR   InterPro; IPR006073; GTP_binding_domain.
DR   InterPro; IPR009019; KH_sf_prok-type.
DR   InterPro; IPR015946; KH_dom-like_a/b.
DR   InterPro; IPR027417; P-loop_NTPase.
DR   InterPro; IPR030388; G_ERA_dom.
DR   UniProtKB/Swiss-Prot; P42182; ERA_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1170
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <2..340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DGK"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="GOA:P19638"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19638"
FT                   /protein_id="CAB57857.1"
FT                   /translation="RFFKSFVHAGRGIWETARTERNFQFHAAAACAVLICGFLVELSII
FT                   EWMIIFLLIGGMFSLELLNTAIEHTVDLITDKHHPLAKAAKDAAAGAVCVFAVISCIIG
FT                   LLIFLPKL"
FT   CDS_pept        459..869
FT                   /transl_table=11
FT                   /gene="CDD"
FT                   /product="cytidine deaminase"
FT                   /db_xref="GOA:P19079"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="PDB:1JTK"
FT                   /db_xref="PDB:1UWZ"
FT                   /db_xref="PDB:1UX0"
FT                   /db_xref="PDB:1UX1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19079"
FT                   /protein_id="CAB57856.1"
FT                   /translation="MNRQELITEALKARDMAYAPYSKFQVGAALLTKDGKVYRGCNIEN
FT                   AAYSMCNCAERTALFKAVSEGDTEFQMLAVAADTPGPVSPCGACRQVISELCTKDVIVV
FT                   LTNLQGQIKEMTVEELLPGAFSSEDLHDERKL"
XX
SQ   Sequence 1170 BP; 354 A; 223 C; 278 G; 315 T; 0 other;
     tcgattcttc aaaagcttcg tgcatgcagg ccggggcata tgggaaacag cgcggacgga        60
     gcggaatttc caatttcatg ccgcagccgc ctgcgctgtt ctcatttgcg gcttccttgt       120
     agagctcagc attattgagt ggatgattat attccttttg ataggtggta tgttttcgct       180
     tgaactttta aatacagcca ttgaacatac ggttgattta ataactgaca aacatcaccc       240
     tcttgctaaa gcggccaagg acgctgccgc cggggctgtt tgcgtttttg ccgtgatttc       300
     gtgtatcatt ggtttactta tttttttgcc aaagctgtaa tggctgaaaa ttcttacatt       360
     tattttacat ttttagaaat gggcgtgaaa aaaagcgcgc gattatgtaa aatataaagt       420
     gatagcggta ccattatagg taagagagga atgtacacat gaacagacaa gaattaataa       480
     cagaagcttt aaaagcgcgt gatatggcat atgcgccgta ttccaaattc caagtaggag       540
     ccgctcttct taccaaggat ggaaaagtgt acagaggctg caatattgag aacgcggcat       600
     acagcatgtg caattgcgcc gagcgtaccg ctttatttaa agctgtttct gaaggggata       660
     cagagtttca gatgctggcc gttgcggctg acacccctgg accagtatct ccgtgcggag       720
     cctgccgaca ggtgatttct gagctttgca caaaagacgt tattgtcgta ctgactaatt       780
     tacaaggaca aataaaagaa atgactgtgg aagaattatt gccaggcgca ttttcatcgg       840
     aggatttaca tgacgaacga aagctttaaa tcaggatttg tatccaatta ttggaagacc       900
     aaacgtagga aaatctacat ttttgaacag agtcattgga caaaaaatcg cgatcatgag       960
     cgataagccc caaacgacga gaaacaaggt gcaaggagta ctgacgacag gcacatcaca      1020
     aaccattttt attgacacac cagggattca taaacctaag cataaacttg gggactttat      1080
     gatgaaagtg gcgcaaaata cattaaaaga agtcgatttg atcttgttta tgatcaatgc      1140
     tgaggaaggc tacgggaagg gcgacgaatt                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page