(data stored in SCRATCH zone)

GenBank: X52144

LOCUS       X52144                  1106 bp    DNA     linear   BCT 26-JUL-2016
DEFINITION  Bacillus subtilis DNA for ORF17, small cytoplasmic RNA and partial
            dnaX gene.
ACCESSION   X52144
VERSION     X52144.1
KEYWORDS    dnaX gene; Scr gene; small cytoplasmic RNA.
SOURCE      Bacillus subtilis subsp. subtilis str. 168
  ORGANISM  Bacillus subtilis subsp. subtilis str. 168
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
REFERENCE   1  (bases 1 to 1106)
  AUTHORS   Struck,J.C., Far,R.K., Schroder,W., Hucho,F., Toschka,H.Y. and
            Erdmann,V.A.
  TITLE     Characterization of a 17 kDa protein gene upstream from the small
            cytoplasmic RNA gene of Bacillus subtilis
  JOURNAL   Biochim. Biophys. Acta 1050 (1-3), 80-83 (1990)
   PUBMED   1698458
REFERENCE   2  (bases 1 to 1106)
  AUTHORS   Struck,J.C.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-MAR-1990) Struck J.C.R., FU Berlin Institut f
            Biochemie, Thielallee 63, D 1000 Berlin 33
COMMENT     See  for overlapping sequence.

            Data kindly reviewed (07-NOV-1990) by Struck J.
FEATURES             Location/Qualifiers
     source          1..1106
                     /organism="Bacillus subtilis subsp. subtilis str. 168"
                     /mol_type="genomic DNA"
                     /strain="168"
                     /sub_species="subtilis"
                     /type_material="type strain of Bacillus subtilis"
                     /db_xref="taxon:224308"
     regulatory      44..49
                     /regulatory_class="promoter"
                     /note="-35 region"
     regulatory      69..74
                     /regulatory_class="promoter"
                     /note="-10 region"
     CDS_pept        129..614
                     /note="unnamed protein product; ORF17 (AA 1-161)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="CAA36389.1"
                     /db_xref="GOA:P21335"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/Swiss-Prot:P21335"
                     /translation="MTQDELYMKEAIKEAKKAEEKGEVPIGAVLVINGEIIARAHNLR
                     ETEQRSIAHAEMLVIDEACKALGTWRLEGATLYVTLEPCPMCAGAVVLSRVEKVVFGA
                     FDPKGGCSGTLMNLLQEERFNHQAEVVSGVLEEECGGMLSAFFRELRKKKKAARKNLS
                     E"
     regulatory      620..625
                     /regulatory_class="promoter"
                     /note="-35 region"
     regulatory      643..648
                     /regulatory_class="promoter"
                     /note="-10 region"
     misc_feature    693..963
                     /note="scRNA coding region"
     regulatory      1030..1035
                     /regulatory_class="promoter"
                     /note="-35 region"
     regulatory      1053..1058
                     /regulatory_class="promoter"
                     /note="-10 region"
     CDS_pept        1091..>1106
                     /note="unnamed protein product; dnaX gene product (AA 1-5)
                     (1106 is 1st base in codon)"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="CAA36390.1"
                     /db_xref="GOA:P09122"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR012763"
                     /db_xref="InterPro:IPR022754"
                     /db_xref="UniProtKB/Swiss-Prot:P09122"
                     /translation="MSYQA"
ORIGIN
        1 tgatcatgtc tacaatgaga agggctttat ctgctttgga caatcgacag tctcctttcc
       61 gtttcagtta tagttaatat gtagcctttt taggcaatga aaaaactttg aaaagagagc
      121 ttatccttat gacacaagat gaactttata tgaaagaagc aattaaagaa gcgaaaaagg
      181 ctgaagagaa aggtgaagtg ccaataggtg cggtgcttgt cattaatggt gaaattatag
      241 cgcgtgcgca taatttaaga gagactgaac agcgatctat tgcccatgca gaaatgcttg
      301 taattgatga agcgtgtaag gcactcggaa catggcggct ggaaggtgcg actctttatg
      361 tgacgcttga gccttgtcca atgtgtgctg gtgcagtcgt actttctcga gtggaaaaag
      421 tggtttttgg cgcatttgat ccgaaaggcg gctgttcagg cacgctaatg aaccttcttc
      481 aggaggaacg ctttaatcat caggctgaag tggtgagcgg tgtgcttgag gaagaatgcg
      541 gcggaatgct cagtgcgttt ttcagagaac taagaaaaaa gaagaaagcc gccaggaaaa
      601 acttgtctga atagtacggt tgcaattttt aggggaaaca gatatactta agtgtgcatc
      661 gtaatagatg caacataaaa tttgatattt attttgccgt gctaagcggg gaggtagcgg
      721 tgccctgtac ctgcaatccg ctctagcagg gccgaatccc ttctcgaggt tcgtttactt
      781 taaggcctgc cttaagtaag tggtgttgac gtttgggtcc tgcgcaatgg gaattcatga
      841 accatgtcag gtccggaagg aagcagcatt aagtgaaacc tctcatgtgc cgcagggttg
      901 cctgggccga gctaactgct taagtaacgc ttagggtagc gaatcgacag aaggtgcacg
      961 gtaaatcaat catcaaattt tcagactcac ctaatattag gtgagttttt tgttatgtaa
     1021 aaagagcttt tggaatcgaa acaaggttca tgtataatgg gaatgatgaa taacggagga
     1081 gggcaaaccc gtgagttacc aagctt
//

If you have problems or comments...

PBIL Back to PBIL home page