(data stored in ACNUC31108 zone)

EMBL: X53517

ID   X53517; SV 1; linear; mRNA; STD; ROD; 1158 BP.
XX
AC   X53517;
XX
DT   17-FEB-1992 (Rel. 31, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   R.norvegicus mRNA for antigen CD37
XX
KW   CD37 antigen.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1158
RA   Classon B.J.;
RT   ;
RL   Submitted (27-JUN-1990) to the INSDC.
RL   Classon B.J., MRC Cellular Immunology Unit, Sir William Dunn School of
RL   Pathology, University of Oxford, Oxford OX1 3RE, England.
XX
RN   [2]
RP   1-1158
RX   DOI; 10.1084/jem.172.3.1007.
RX   PUBMED; 2388030.
RA   Classon B.J., Williams A.F., Willis A.C., Seed B., Stamenkovic I.;
RT   "The primary structure of the human leukocyte antigen CD37, a species
RT   homologue of the rat MRC OX-44 antigen";
RL   J. Exp. Med. 172(3):1007-1007(1990).
XX
DR   MD5; 64f1e129f5fb9e4e8f3a42be960efe6e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1158
FT                   /organism="Rattus norvegicus"
FT                   /strain="PVG/DA"
FT                   /mol_type="mRNA"
FT                   /clone_lib="cDNA"
FT                   /germline
FT                   /db_xref="taxon:10116"
FT   CDS_pept        58..903
FT                   /product="antigen CD37"
FT                   /db_xref="GOA:P31053"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31053"
FT                   /protein_id="CAA37596.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLSVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANGSEELFVPCSCYNSTATNDSSGFDKLFLSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREGCARSLQKWLHNNIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
FT                   "
XX
SQ   Sequence 1158 BP; 209 A; 366 C; 292 G; 291 T; 0 other;
     ggccaacacc tcttctgtct gggttcctca agctgctcgc tccccatcta ggcgaagatg        60
     tccgcccaag agagttgcct cagcctcatc aagtacttcc tcttcgtttt caacctcttc       120
     ttctttgtac taggaggcct gattttctgc tttggcacct ggatcctcat tgacaagacc       180
     agcttcgtgt cctttgtggg cttgtccttc gtgccactgc agacctggtc caaggtcctg       240
     tcggtctcgg gtgtcctcac catggccctg gctctcctgg gctgtgtggg ggctctaaag       300
     gagctgcgct gtcttctggg cctgtatttc ggaatgctgc tgctcctgtt tgccacacag       360
     attaccttgg ggatcctcat ttccactcag cgagtccggc tggagcgaag ggtgcaggaa       420
     ttggtgttac ggaccatcca gagctaccgc acgaatccgg atgagacagc tgctgaggag       480
     agctgggact atgcgcagtt tcagctgcgc tgctgcggtt ggcaatctcc gcgggactgg       540
     aacaaggccc agatgctgaa agcaaacggg tccgaagagc tctttgtgcc ctgctcctgc       600
     tacaattcca ccgcgaccaa tgactcctcc ggctttgata agctctttct ctcccagcta       660
     agccggctgg ggccgcgggc gaagctgagg cagactgctg acatatgtgc actccccgca       720
     aaagcccata tataccgtga gggctgcgcg cggagcctcc agaagtggct gcacaacaat       780
     atcatctcca tagtgggaat ttgtctggga gtcggtcttc ttgagctcgg cttcatgaca       840
     ctctcgatat tcctgtgtag aaatctggat cacgtctatg accggctggc ccggtaccgc       900
     taggccccaa cccaccggtt ggcacccacg cacctccatg cagtcaggaa ctgtttcctt       960
     cctggttggt tacaggcttg gagccctgtg cctcaggcct cattctctgg ggacccagat      1020
     gtctgcccta agacagcctt cacttccccc acagggccag ggactttcga gcccagcttc      1080
     cttccctgct ccctcctccc cacaccatct gtctgccacc tcccacatga cacctcaaat      1140
     aaatcccctt cttttttg                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page