(data stored in SCRATCH zone)

GenBank: X53560

LOCUS       X53560                  6822 bp    DNA     linear   BCT 18-APR-2005
DEFINITION  B. stearothermophilus pdhA, pdhB, pdhC, pdhD genes for pyruvate
            dehydrogenase multienzyme complex (E.C. numbers 1.2.4.1, 2.3.1.12,
            1.8.1.4).
ACCESSION   X53560
VERSION     X53560.1
KEYWORDS    dihydrolipoamide acetyltransferase; dihydrolipoamide dehydrogenase;
            pyruvate dehydrogenase; pyruvate dehydrogenase alpha subunit;
            pyruvate dehydrogenase E1-beta subunit.
SOURCE      Geobacillus stearothermophilus
  ORGANISM  Geobacillus stearothermophilus
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae;
            Geobacillus.
REFERENCE   1  (bases 4182 to 6822)
  AUTHORS   Hawkins,C.F., Borges,A. and Perham,R.N.
  TITLE     Cloning and sequence analysis of the genes encoding the alpha and
            beta subunits of the E1 component of the pyruvate dehydrogenase
            multienzyme complex of Bacillus stearothermophilus
  JOURNAL   Eur. J. Biochem. 191 (2), 337-346 (1990)
   PUBMED   2200674
REFERENCE   2  (bases 1 to 4181)
  AUTHORS   Borges,A., Hawkins,C.F., Packman,L.C. and Perham,R.N.
  TITLE     Cloning and sequence analysis of the genes encoding the
            dihydrolipoamide acetyltransferase and dihydrolipoamide
            dehydrogenase components of the pyruvate dehydrogenase multienzyme
            complex of Bacillus stearothermophilus
  JOURNAL   Eur. J. Biochem. 194 (1), 95-102 (1990)
   PUBMED   2253629
REFERENCE   3  (bases 1 to 6822)
  AUTHORS   Hawkins,C.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JUN-1990) Hawkins, C.F., Cambridge University, Dept.
            of Biochemistry, Tennis Court Road, Cambridge CB2 1QW, England
FEATURES             Location/Qualifiers
     source          1..6822
                     /organism="Geobacillus stearothermophilus"
                     /mol_type="genomic DNA"
                     /strain="NCA 1503"
                     /db_xref="taxon:1422"
                     /clone="pBst42 & pBst27"
                     /clone_lib="genomic (plasmid)"
     CDS_pept        1..288
                     /note="unnamed protein product; Protein sequence is in
                     conflict with the conceptual translation; ORF 1"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="CAA37626.1"
                     /db_xref="GOA:P21878"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR013200"
                     /db_xref="UniProtKB/Swiss-Prot:P21878"
                     /translation="EFRFVRWHDVSTDVLPAGGSKAEGIRLMIEKLGIDKGDVYAFGD
                     GLNDIEMLSFVGTGVAMGNAHEEVKRVADFVTKPVSEEGIWHGLKQLQLIP"
     regulatory      287..328
                     /regulatory_class="terminator"
                     /note="rho-independant terminator"
     regulatory      1262..1272
                     /regulatory_class="ribosome_binding_site"
     CDS_pept        1290..1367
                     /note="unnamed protein product; ORF 2"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="CAA37627.1"
                     /db_xref="UniProtKB/TrEMBL:Q45650"
                     /translation="MSAPFSVSVAPSGGCFLFLLYFWVH"
     regulatory      1418..1424
                     /regulatory_class="ribosome_binding_site"
     gene            <1430..>2539
                     /gene="pdhA"
     CDS_pept        1430..2539
                     /gene="pdhA"
                     /note="E1 alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (lipoamide)"
                     /protein_id="CAA37628.1"
                     /db_xref="GOA:P21873"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR017596"
                     /db_xref="PDB:1W85"
                     /db_xref="PDB:1W88"
                     /db_xref="PDB:3DUF"
                     /db_xref="PDB:3DV0"
                     /db_xref="PDB:3DVA"
                     /db_xref="UniProtKB/Swiss-Prot:P21873"
                     /translation="MGVKTFQFPFAEQLEKVAEQFPTFQILNEEGEVVNEEAMPELSD
                     EQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPTAGQEASQIASHFALEKEDFILPG
                     YRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLK
                     MRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVAK
                     TLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSG
                     DDPTRYRSKELENEWAKKDPLVRFRKFLEAKGLWSEEEENNVIEQAKEEIKEAIKKAD
                     ETPKQKVTDLISIMFEELPFNLKEQYEIYKEKESK"
     mat_peptide     1430..2536
                     /gene="pdhA"
                     /product="pyruvate dehydrogenase (lipoamide)"
                     /note="E1 alpha subunit"
     prim_transcript <1430..>2539
                     /gene="pdhA"
                     /note="E1 alpha subunit"
     regulatory      2525..2534
                     /regulatory_class="ribosome_binding_site"
                     /gene="pdhA"
     gene            <2543..>3520
                     /gene="pdhB"
     CDS_pept        2543..3520
                     /gene="pdhB"
                     /note="E1 beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (lipoamide)"
                     /protein_id="CAA37629.1"
                     /db_xref="GOA:P21874"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR015941"
                     /db_xref="PDB:1W85"
                     /db_xref="PDB:1W88"
                     /db_xref="PDB:3DUF"
                     /db_xref="PDB:3DV0"
                     /db_xref="PDB:3DVA"
                     /db_xref="UniProtKB/Swiss-Prot:P21874"
                     /translation="MAQMTMVQAITDALRIELKNDPNVLIFGEDVGVNGGVFRATEGL
                     QAEFGEDRVFDTPLAESGIGGLAIGLALQGFRPVPEIQFFGFVYEVMDSICGQMARIR
                     YRTGGRYHMPITIRSPFGGGVHTPELHSDSLEGLVAQQPGLKVVIPSTPYDAKGLLIS
                     AIRDNDPVIFLEHLKLYRSFRQEVPEGEYTIPIGKADIKREGKDITIIAYGAMVHESL
                     KAAAELEKEGISAEVVDLRTVQPLDIETIIGSVEKTGRAIVVQEAQRQAGIAANVVAE
                     INERAILSLEAPVLRVAAPDTVYPFAQAESVWLPNFKDVIETAKKVMNF"
     mat_peptide     2543..3517
                     /gene="pdhB"
                     /product="pyruvate dehydrogenase (lipoamide)"
                     /note="E1 beta subunit"
     prim_transcript <2543..>3520
                     /gene="pdhB"
                     /note="E1 beta subunit"
     regulatory      3579..3583
                     /regulatory_class="ribosome_binding_site"
     gene            3594..>4880
                     /gene="pdhC"
     CDS_pept        3594..4880
                     /gene="pdhC"
                     /note="E2"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide acetyltransferase"
                     /protein_id="CAA37630.1"
                     /db_xref="GOA:P11961"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="PDB:1B5S"
                     /db_xref="PDB:1EBD"
                     /db_xref="PDB:1LAB"
                     /db_xref="PDB:1LAC"
                     /db_xref="PDB:1W3D"
                     /db_xref="PDB:1W4E"
                     /db_xref="PDB:1W4F"
                     /db_xref="PDB:1W4G"
                     /db_xref="PDB:1W85"
                     /db_xref="PDB:1W88"
                     /db_xref="PDB:2PDD"
                     /db_xref="PDB:2PDE"
                     /db_xref="PDB:3DUF"
                     /db_xref="PDB:3DV0"
                     /db_xref="PDB:3DVA"
                     /db_xref="UniProtKB/Swiss-Prot:P11961"
                     /translation="MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKA
                     VVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTET
                     VSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLK
                     EDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSK
                     HTAPHVTLMDEADVTKLVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTS
                     IDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKL
                     TPGEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPMLA
                     LSLSFDHRMIDGATAQKALNHIKRLLSDPELLLMEA"
     mat_peptide     3594..4877
                     /gene="pdhC"
                     /product="dihydrolipoamide acetyltransferase"
                     /note="E2"
     prim_transcript <3595..>4880
                     /gene="pdhC"
                     /note="E2"
     regulatory      4871..4875
                     /regulatory_class="ribosome_binding_site"
                     /gene="pdhC"
     gene            <4885..>6297
                     /gene="pdhD"
     CDS_pept        4885..6297
                     /gene="pdhD"
                     /note="E3"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="CAA37631.1"
                     /db_xref="GOA:P11959"
                     /db_xref="InterPro:IPR000815"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="PDB:1EBD"
                     /db_xref="UniProtKB/Swiss-Prot:P11959"
                     /translation="MVVGDFAIETETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLG
                     GVCLNVGCIPSKALISASHRYEQAKHSEEMGIKAENVTIDFAKVQEWKASVVKKLTGG
                     VEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTFKNAIIATGSRPIELPNFKFS
                     NRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSGFEKQ
                     MAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEANGETKTIDADYVLVTVGRRP
                     NTDELGLEQIGIKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPALAHKASYEGKVAAE
                     AIAGHPSAVDYVAIPAVVFSDPECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALN
                     DTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAELGLAIEAGMTAEDIALTIHAHPTLG
                     EIAMEAAEVALGTPIHIITK"
     mat_peptide     4885..6294
                     /gene="pdhD"
                     /product="dihydrolipoamide dehydrogenase"
                     /note="E3"
     prim_transcript <4885..>6297
                     /gene="pdhD"
                     /note="E3"
ORIGIN
        1 gaattccgtt ttgtccgttg gcacgatgtg tcgaccgatg tgctgccggc agggggatcg
       61 aaagcggagg ggatccgcct gatgattgag aagctcggga ttgacaaagg cgatgtgtat
      121 gcgttcggcg atgggctgaa cgacattgaa atgttgtcgt tcgtcggaac aggagtggcg
      181 atgggaaatg cccatgagga agtgaaacgg gtcgccgatt ttgtaacgaa accggtcagt
      241 gaagaaggca tatggcacgg attgaaacaa ttgcaattga ttccataaac agctgccccg
      301 ggccgctcat tcggcggggc agctgtttgg catggccggc cacggttcag cgcccgatcg
      361 ggatcgcccc gtctggcact tggaacgggt cggccggatt gatgcggtca taaaacataa
      421 tgccgtttaa atggtcgatt tcatgctgga agacgatggc cggcaatcct ttgaggcgca
      481 aggtgacttc ctcgccgtcg agcgtcgtgc cggtgaccgt gatgcgggca tagcgcagta
      541 cgtatccggg cacatcacgg tcgaccgaca ggcagccttc ccccgtcgtc aaataacatt
      601 gctgcacaga gtggctgacg attttcggat tgaacaaggc atagctgtac agcgttccgt
      661 tttcatcagt gacatgaacg gcaatcatcc gtttggagac gttgatttgc ggagcggcga
      721 ggccgatgcc ggccgcaggc cgtatttggc cgccagttcc ggatcttggc tcattttcac
      781 atagtcaagc aagctttgca aaatgcgttt gtcttcctct gaaggcggca gcggaacggg
      841 ctcagccact ttccgcagcg tcggatgccc ttctttaatg atatctttca tggtgatcat
      901 tcgccttttc actcctgtct ctcgcatcgc ggtctacagt gttagtctaa caaaaatgcc
      961 tgtgcgccgt aaatgaaaat gcggccgtct ggagatatta tcggcgtata aggaataaat
     1021 tggaaaataa acttaagaaa gcgctgtcaa taacatgaac ggacattgcg ttttgcattt
     1081 cccgaaaaat ataatacaga attaatacag tgttgtttcg atgtggtata acagatggtt
     1141 tcaggaatgt tcctgattcc aaatacaacc aggagacaaa agggaaagca acggaaaatc
     1201 aaagtcgttg acggcgtgaa aaataaagtg taaactaaaa cttgagaaca gacgctgtgt
     1261 taatgaggat ataaaaaata gtaatacaga tgtcggcgcc gttttcggtt tccgttgcgc
     1321 caagcggcgg ctgcttttta tttcttcttt acttttgggt acattaatag tatatggatg
     1381 aagacagcct gatttccaaa tttcttgatg aaaggcagag gtgaacaaga tgggtgtaaa
     1441 gaccttccaa ttcccatttg cggagcagct cgagaaagtg gccgagcagt tcccgacatt
     1501 tcaaattttg aatgaggaag gagaagtcgt caatgaagag gcgatgccgg agctgagcga
     1561 tgagcagctg aaagagctga tgcgtcgcat ggtgtatacg cgcattcttg accagcgctc
     1621 catttcgttg aaccgccaag ggagactcgg gttttatgcg ccgaccgccg ggcaggaagc
     1681 gagccaaatt gccagccatt ttgcattgga aaaagaagat tttattttgc cgggataccg
     1741 cgacgttccg caaatcattt ggcatgggct tccgctgtat caggcgtttt tgttctcgcg
     1801 cggccatttc catggtaacc aaattccaga aggcgtaaac gtcctgccgc cgcaaatcat
     1861 tatcggcgcc caatacatcc aagcagctgg tgtggcgctc ggcttgaaaa tgcggggcaa
     1921 aaaagcagtg gcgattacat atacgggcga cggcggcacg tcgcaaggcg atttctacga
     1981 agggatcaac tttgcggggg cgtttaaggc gccggccatc tttgtcgtgc aaaacaaccg
     2041 ctttgccatc tcgacgccgg tcgaaaagca aaccgttgcc aaaacattgg cgcaaaaagc
     2101 agtcgccgcc ggcattccgg gcattcaagt tgacggcatg gacccgcttg cggtctacgc
     2161 agcggtcaaa gctgctcgcg agcgcgccat taacggcgaa gggccgacgc tcattgaaac
     2221 gctctgcttc cgctatggcc cgcatacgat gtccggtgac gatccaacgc gctatcgttc
     2281 gaaagagttg gaaaacgaat gggcgaagaa agacccactc gtgcgtttcc gcaagttttt
     2341 agaggcgaaa ggcttgtgga gcgaagaaga agaaaacaac gttattgaac aggcaaaaga
     2401 agagattaaa gaagcgatca agaaagcgga cgaaacgccg aagcaaaaag taaccgactt
     2461 gatcagcatc atgtttgaag agctgccgtt caatttgaag gagcagtatg aaatttacaa
     2521 agagaaggag tcgaagtaag ccatggcgca aatgacaatg gttcaggcga tcaccgatgc
     2581 gctgcgtatc gagttgaaaa atgatccgaa cgtgctcatt ttcggggaag acgttggggt
     2641 caacggcggc gtattccggg cgacggaagg gctgcaggcc gaatttggcg aagatcgcgt
     2701 ttttgacacg ccgctcgccg aatcaggaat cggcggcttg gcgatcggtt tggcgctgca
     2761 agggtttcgc ccggtgccgg aaatccagtt tttcggcttc gtgtatgaag tgatggattc
     2821 gatttgcggg caaatggcgc gaatccgcta tcgtacgggc ggacgctacc atatgccgat
     2881 tacgatccgt tctccgtttg gcggcggcgt ccatacgccg gagttgcact cagacagctt
     2941 ggaagggctt gtcgcccaac agccaggctt gaaggttgtc attccgtcga cgccgtatga
     3001 tgcgaaaggg ctgctcatct cggcgattcg cgacaacgac ccggtcattt tccttgaaca
     3061 tttgaagctg taccgttcgt tccgtcagga agtgccggaa ggggaataca cgattccgat
     3121 cggcaaggcg gacattaagc gggaaggaaa agacatcacg atcatcgcgt acggcgccat
     3181 ggtgcatgaa tcgttaaaag cggcggcaga attagagaag gaaggcattt ctgccgaagt
     3241 cgtcgacttg cgtaccgtgc agccgctcga tattgaaacg atcatcggtt cggtcgaaaa
     3301 aacgggccgc gccattgtcg ttcaagaagc gcaacggcag gctggcatcg ccgccaacgt
     3361 cgtggcggag attaacgaac gcgccatctt aagccttgag gcgccggtgt tgcgcgtggc
     3421 cgctccggac acggtctatc cgtttgctca ggcggaatcg gtatggctgc caaactttaa
     3481 agatgtaatc gaaacggcga aaaaagtgat gaacttctaa cagcggacaa attcggggga
     3541 gcggaacgcc ttcccccgcc cattttcggc aaacgatagg aggtagacag acagtggctt
     3601 ttgaatttaa gctgccggac attggcgaag gcatccacga aggtgaaatt gtcaaatggt
     3661 ttgtgaaacc gggcgatgaa gtgaacgaag acgatgtatt gtgcgaagtg caaaatgaca
     3721 aggcggttgt cgaaattccc tccccggtca aagggaaagt gcttgaaatc ctcgtcccgg
     3781 agggaacagt ggcaacggtc gggcaaacgc tcatcacgct cgatgcgccg ggttatgaaa
     3841 acatgacgtt taaaggacaa gagcaagaag aagcgaaaaa agaggaaaaa acggaaacgg
     3901 tgtcgaaaga ggaaaaggtt gacgctgtcg ctcccaatgc accggcagct gaagcggagg
     3961 ctggcccgaa ccgccgcgtc atcgccatgc cgtccgtgcg caagtatgcg cgcgaaaaag
     4021 gcgtcgatat tcggcttgtc caaggaacgg gcaaaaacgg ccgcgtcctg aaagaagata
     4081 ttgacgcttt ccttgccggc ggcgcaaaac cggcaccggc cgcagcggag gaaaaagcgg
     4141 cgccggccgc agcgaaaccg gcgacgacag aaggcgaatt cccggaaacg cgcgagaaaa
     4201 tgagcggcat ccgtcgggcg attgccaaag cgatggtgca ttccaaacat accgctccgc
     4261 acgtgacgct gatggacgaa gccgatgtga cgaagcttgt tgctcaccga aaaaaattca
     4321 aggctattgc cgcggaaaaa ggcatcaagc tgacgttttt gccgtacgtc gtcaaagcgc
     4381 tcgtttccgc gctgcgtgaa tacccagtgt tgaatacgtc cattgatgat gagacggaag
     4441 aaatcatcca gaagcattat tacaatatcg gcatcgccgc tgatacggac cgcggcttgc
     4501 ttgtgccggt cattaaacat gccgatcgca agccgatttt cgccttggcg caagaaatca
     4561 atgagctcgc cgagaaagcg cgcgacggca aactgacgcc gggagaaatg aaaggcgctt
     4621 catgcacgat tacaaacatc ggttcggctg gcgggcaatg gtttaccccg gtcatcaacc
     4681 atccggaagt ggcgattctt ggcatcggcc gcattgcgga aaagccgatc gtccgtgacg
     4741 gtgaaattgt cgctgccccg atgctggcgc tctcgctcag ctttgaccac cggatgatcg
     4801 acggggcgac agcgcaaaaa gcgctcaacc atatcaaacg gctgttgagt gacccggaat
     4861 tattactaat ggaggcgtaa aacgatggta gttggcgatt ttgcaattga aacggaaacg
     4921 cttgtcgtcg gcgccggtcc tggcgggtat gtcgccgcca tccgcgccgc gcagctcgga
     4981 caaaaagtga cgattgtgga aaagggcaat ttaggcggcg tctgcttaaa tgttggctgc
     5041 atcccgtcaa aggcgctgat ctccgcaagc catcgctatg agcaggcgaa gcattccgaa
     5101 gaaatgggca ttaaggcgga gaacgtcacc atcgattttg ccaaagtgca agaatggaaa
     5161 gcaagcgtcg tgaaaaaatt aacgggcggc gtcgaagggc tgttaaaagg aaacaaagta
     5221 gagatcgtca aaggggaagc gtattttgtc gacgccaata cggtgcgtgt cgtcaacggc
     5281 gacagcgcgc agacgtatac gttcaaaaac gcgattatcg ccaccggctc gcgcccgatt
     5341 gagctgccga acttcaagtt ttccaaccgc attcttgact cgacgggagc tctcaacctt
     5401 ggggaagtgc cgaaatcgct cgtggtcatc ggcggcggct atattggcat cgaactcggt
     5461 acggcttacg ccaactttgg gacgaaagtg accattttag aaggagccgg cgaaattttg
     5521 tccggttttg agaagcaaat ggctgccatc atcaagaagc gcctgaagaa aaaaggcgtt
     5581 gaagtcgtga cgaacgcatt ggcgaaaggg gccgaagaac gcgaagacgg cgtcacggtc
     5641 acgtatgagg cgaatggtga aacgaaaacg attgacgccg actatgtgct cgtcaccgtc
     5701 ggccgccgtc cgaatacaga tgaacttggt cttgaacaaa tcggcatcaa aatgacgaac
     5761 cgcggcttga ttgaagtgga ccaacaatgc cggacaagcg tgccgaacat ttttgcgatc
     5821 ggcgacatcg ttccaggtcc ggcgctcgcc cataaagcgt cgtatgaagg aaaagtggct
     5881 gcggaagcta tcgccggcca tccgtcggca gtcgattacg tggccattcc agctgttgtc
     5941 ttctccgatc cggaatgcgc gtcggtcggc tattttgagc agcaggcgaa agacgagggc
     6001 attgacgtca ttgccgcgaa attcccgttt gctgccaacg gccgcgcctt ggcgctgaac
     6061 gatacggacg gcttcttgaa gctcgttgtc cgcaaagagg acggcgtcat cattggtgcg
     6121 caaatcatcg gtccaaatgc ttctgacatg atcgccgagc ttgggctcgc cattgaagcc
     6181 ggcatgacgg cggaagacat cgctttgacg atccatgccc atccgacgct tggcgaaatc
     6241 gccatggaag cggcggaagt ggcgcttggc acaccgattc atatcattac gaagtaactg
     6301 tgaaacgacc gggcttggcc cggtcgtttt tcttatcatg cgggaatggc gcatttcttg
     6361 tcctgttttt catactattt tccgctttcg tttcatatcg ttatggtaaa gaaaagcggg
     6421 agatggaaat gatgaaagcg tatgtcgcct ttttgctgca aatgatgatt tggagcagtt
     6481 tttccttgat cgagtggctg tcggggcggg accggccgtt tttccgcggc ttgatgttgt
     6541 gcgtcttcat gtacatagcg tttttactgg cgcgccagct cggcttggcg acgcgcaaag
     6601 cgctccttac aacagctgcc acggcggcgg tgtattttac cggccagcat ttcatatggc
     6661 aatctattcc atgatctgcc ccttgggtgc ggaagcggcg cggttcggcg aacaaaaaac
     6721 agcggtccca tgccgctgtt tacaccggcc gaacgacatc gtccggccgc tgaataaacg
     6781 cagttcgccg ccaagcgttt tggtcatcca tttgctgaat tc
//

If you have problems or comments...

PBIL Back to PBIL home page