(data stored in SCRATCH zone)

GenBank: X53696

LOCUS       X53696                  1920 bp    DNA     linear   BCT 18-APR-2005
DEFINITION  E. coli GSA gene for Glutamate 1-semialdehyde aminotransferas.
ACCESSION   X53696
VERSION     X53696.1
KEYWORDS    .
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 1920)
  AUTHORS   Grimm,B., Bull,A. and Breu,V.
  TITLE     Structural genes of glutamate 1-semialdehyde aminotransferase for
            porphyrin synthesis in a cyanobacterium and Escherichia coli
  JOURNAL   Mol. Gen. Genet. 225 (1), 1-10 (1991)
   PUBMED   1900346
REFERENCE   2  (bases 1 to 1920)
  AUTHORS   Grimm,B., Smith,A.J., Kannangara,C.G. and Smith,M.
  TITLE     Gabaculine-resistant glutamate 1-semialdehyde aminotransferase of
            Synechococcus. Deletion of a tripeptide close to the NH2 terminus
            and internal amino acid substitution
  JOURNAL   J. Biol. Chem. 266 (19), 12495-12501 (1991)
   PUBMED   1905724
REFERENCE   3  (bases 1 to 1920)
  AUTHORS   Grimm,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUL-1990) B. Grimm, CARLSBERG LABORATORY, DEPT OF
            PHYSIOLOGY, GAMLE CARLSBERG VEJ 10, DK 2500 COPENHAGEN VALBY,
            DENMARK
FEATURES             Location/Qualifiers
     source          1..1920
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
     regulatory      418..423
                     /regulatory_class="minus_35_signal"
     regulatory      431..435
                     /regulatory_class="minus_10_signal"
     regulatory      542..546
                     /regulatory_class="ribosome_binding_site"
     gene            <553..>1833
                     /gene="GSA"
     mRNA            <553..>1833
                     /gene="GSA"
     CDS_pept        553..1833
                     /gene="GSA"
                     /EC_number="5.4.3.8"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="CAA37734.1"
                     /db_xref="GOA:P23893"
                     /db_xref="InterPro:IPR004639"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/Swiss-Prot:P23893"
                     /translation="MRKSENLYQAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYL
                     YDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTEL
                     VPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTL
                     GQPNSPGVPADFAKYTLTCTYNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPE
                     FLPGLRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAF
                     GGRRDVMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGVHETLDELTTRLAEG
                     LLEAAEEAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHMMLDEGVY
                     LAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL"
     prim_transcript <553..>1833
                     /gene="GSA"
     repeat_region   1840..1860
                     /rpt_type=INVERTED
     repeat_region   1863..1883
                     /rpt_type=INVERTED
ORIGIN
        1 ggatccccga accacctgct tccggcgcgt atttgcgcac caaaaagtag ccaaacatcg
       61 ccagcaccgc cgaacagaga aaagcgacgg ttaacagaag cggataatta tcagcagtat
      121 gtaccagcgc ccccatacgt tggttctgca accaggcgac acctttgtca aaagcaaccg
      181 ctgccagccc aacaagcgtg ccgacgactg ccgccataaa caaaatggct aactgggttt
      241 tatcgcgctc aagaagttgg cgaatcagtt gtctgcgtcg caggcgcgcg gcctgcgtgt
      301 ttctaaagag ggagtatcag ttttcatcca atgatcactt attggtcata caaataagat
      361 gacggcattt tactcgcacg ttccatgaaa atcctttgca aagcgtaatg tttcaaatgc
      421 acaaaacttt taatactcta agaaatcagg attgcaccag tacaagcagc ctgatgtttg
      481 acgagtattt aacttgttat gaataacata gaatagcagc cattcacttt ttctacgaat
      541 caggaaccct ccatgaggaa gtctgaaaat ctttaccagg cagcgcgcga gctgatccct
      601 ggcggtgtga actcccctgt tcgcgccttt actggcgtgg gcggcactcc actgtttatc
      661 gaaaaagcgg acggcgctta tctgtacgat gttgatggca aagcctatat cgattatgtc
      721 ggttcctggg ggccgatggt gctgggccat aaccatccgg caatccgcaa tgccgtgatt
      781 gaagccgccg agcgtggttt aagctttggt gcaccaaccg aaatggaagt gaaaatggcg
      841 caactggtga ccgaactggt cccgaccatg gatatggtgc gcatggtgaa ctccggcact
      901 gaagcgacca tgagcgccat ccgcctggcc cgtggtttta ccggtcgcga caaaattatt
      961 aaatttgaag ggtgttacca tggtcacgct gactgcctgc tggtgaaagc cggttctggc
     1021 gcactcacgt taggccagcc aaactcgccg ggcgttccgg cagatttcgc caaatatacc
     1081 ttaacctgta cttataatga tctggcttct gtacgcgccg catttgagca atacccgcaa
     1141 gagattgcct gtattatcgt cgagccggtg gcaggcaata tgaactgtgt tccgccgctg
     1201 ccagagttcc tgccaggtct gcgcgcgctg tgcgacgaat ttggcgcgtt gctgatcatc
     1261 gatgaagtga tgaccggttt ccgcgtagcg ctagctggcg cacaggatta ttacggcgta
     1321 gtgccagatt taacctgcct cggcaaaatc atcggcggtg gaatgccggt aggcgcattc
     1381 ggtggtcgtc gtgatgtaat ggatgcgctg gccccgacgg gtccggtcta tcaggcgggt
     1441 acgctttccg gtaacccgat tgcgatggca gcgggtttcg cctgtctgaa tgaagtcgcg
     1501 cagccgggcg ttcacgaaac gctggatgag ctgacaacac gtctggcaga aggtctgctg
     1561 gaagcggcag aagaagccgg aattccgctg gtcgttaacc acgttggcgg catgttcggt
     1621 attttcttta ccgacgccga gtccgtgacg tgctatcagg atgtgatggc ctgtgacgtg
     1681 gaacgcttta agcgtttctt ccatatgatg ctggacgaag gtgtttacct ggcaccgtca
     1741 gcgtttgaag cgggctttat gtccgtggcg cacagcatgg aagatatcaa taacaccatc
     1801 gatgctgcac gtcgggtgtt tgcgaagttg tgatccagca tggtttgtcg gatgcggcgt
     1861 gaacgcctta tccgacctac gattcggggc cgtttgtagg cccgataaga cgcgccagcg
//

If you have problems or comments...

PBIL Back to PBIL home page