(data stored in SCRATCH zone)

EMBL: X54871

ID   X54871; SV 1; linear; mRNA; STD; HUM; 1630 BP.
XX
AC   X54871;
XX
DT   28-APR-1992 (Rel. 31, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   H.sapiens mRNA for ras-related protein Rab5b
XX
KW   ras-related protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Wilson D.;
RT   ;
RL   Submitted (02-OCT-1990) to the INSDC.
RL   Wilson D., Boston Childrens Hospital-Hematology Division, 300 Longwood
RL   Ave., Boston, MA 02115, USA.
XX
RN   [2]
RP   1-1630
RA   Wilson D.B.;
RT   ;
RL   Submitted (02-OCT-1990) to the INSDC.
RL   D.B. Wilson, BOSTON CHILDRENS HOSPITAL, HEMATOLOGY DIVISION, 300 LONGWOOD
RL   AVENUE, BOSTON MA 02115, USA
XX
RN   [3]
RX   DOI; 10.1172/JCI115683.
RX   PUBMED; 1541686.
RA   Wilson D.B., Wilson M.P.;
RT   "Identification and subcellular localization of human rab5b, a new member
RT   of the ras-related superfamily of GTPases";
RL   J. Clin. Invest. 89(3):996-1005(1992).
XX
DR   MD5; 1856ccbe2303c4693bd295c755453728.
DR   Ensembl-Gn; ENSG00000111540; homo_sapiens.
DR   Ensembl-Tr; ENST00000360299; homo_sapiens.
DR   Ensembl-Tr; ENST00000448789; homo_sapiens.
DR   Ensembl-Tr; ENST00000553116; homo_sapiens.
DR   EuropePMC; PMC1346919; 16414985.
DR   EuropePMC; PMC1933373; 17494077.
DR   EuropePMC; PMC193924; 12972621.
DR   EuropePMC; PMC2139891; 9151665.
DR   EuropePMC; PMC517414; 15322016.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1630
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_type="endothelial"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        21..668
FT                   /product="ras related protein Rab5b"
FT                   /db_xref="GOA:P61020"
FT                   /db_xref="H-InvDB:HIT000321943.11"
FT                   /db_xref="HGNC:HGNC:9784"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2HEI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61020"
FT                   /protein_id="CAA38653.1"
FT                   /translation="MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQF
FT                   HEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITN
FT                   QETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETS
FT                   AKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN"
XX
SQ   Sequence 1630 BP; 395 A; 424 C; 411 G; 400 T; 0 other;
     cccattctga taatctggcc atgactagca gaagcacagc taggcccaat gggcaacccc        60
     aggccagcaa aatttgccag ttcaaattgg tcctgctggg agaatctgca gtgggaaagt       120
     caagcctggt attacgtttt gtcaaagggc agttccatga gtaccaggag agcaccattg       180
     gagcggcctt cctcacccag tccgtttgtc tagatgacac aacagtgaag tttgagatct       240
     gggacacagc tgggcaggag cgatatcaca gcttagcccc catgtactac aggggtgccc       300
     aagctgcaat cgtggtttac gacattacta atcaggaaac ctttgcccga gcaaagacat       360
     gggtgaagga actacagcga caggccagtc ctagcatcgt tattgccctg gcagggaaca       420
     aagctgacct ggccaacaaa cgtatggtgg agtatgaaga ggcccaggca tatgcagatg       480
     acaacagctt attgttcatg gagacttcag ccaagacagc tatgaacgtg aatgatctct       540
     tcctggcaat agctaagaag ttgccaaaga gtgaacccca gaatctggga ggtgcagcag       600
     gccgaagccg gggtgtggat ctccatgaac agtcccagca gaacaagagc cagtgttgta       660
     gcaactgagg gggtggctag cagcaaacaa gtatggagct agcacaagag ctaagaaata       720
     accgccatcc ctacccctcg acacacaacc cctacggtac agcacactag ccctggctcc       780
     aagggctgcc tcctgacagc tccgtcatgg cactttttaa cgcttcagca acaaacacca       840
     ggcagctgtt ccgactggcc tcctaccccc tactctgggg cttgggggtc aactcccccc       900
     aggacttacc ttccaaaaca aactttcttc acttgtatta taggtacaag acagcgactt       960
     acgtatcttt tctcctcctc cctagtgttc ctccccgatt ttttcagaaa acacttctga      1020
     ctcctgtccc ttccccttct gcttttggtc agtccctgtt cttgagcctc ttttctcctc      1080
     tccccaggat gctgtttgtg gtgaacccag gaactgagaa ggaggtttcc agttcattta      1140
     cattaagggc ctgggggaga taaagctcga gcaggaggga gtaaggaaac attccttttt      1200
     gtttttattt ggttggagtt tctcatattt gaaaacattg cggtatccat gatttggcct      1260
     tgtggagggt gttcctaggt agaggtgaga atggggaggc aagatctcag ggacaccaag      1320
     caggaggtgc cgggtaagct aactgggcgg aggtggaggt gcagggtcaa ctgtggctct      1380
     gtaactcttc aaaggccagt ttcccctcac gcagcctctt aggtagcgtt tcccctaatg      1440
     gtgtttcccc taatcgtggg gttggacccc agagtcttcc aaagaatttt cactggttgc      1500
     ctacgtcttt ggctctgctg tagtctgatt ggaggaggga cagtttctgg tacccatcct      1560
     ctgatttata catatgcgtt ttttcccctc tggcctttag atggcctcag ccccagccac      1620
     catatacccg                                                             1630
//

If you have problems or comments...

PBIL Back to PBIL home page