(data stored in ACNUC7421 zone)

EMBL: X55456

ID   X55456; SV 1; linear; genomic DNA; STD; PRO; 2497 BP.
XX
AC   X55456;
XX
DT   04-JAN-1991 (Rel. 26, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 17)
XX
DE   S. typhimurium ilvH and fruR genes coding for the acetolactate synthase II
DE   subunit and PEP:fructose phosphotransferase system repressor
XX
KW   acetolactate synthase; fructose phosphotransferase system repressor;
KW   PEP:fructose phosphotransferase system repressor.
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-2497
RA   Jahreis K.;
RT   ;
RL   Submitted (23-OCT-1990) to the INSDC.
RL   Jahreis K., Abt. Genetik, FB Biologie Chemie, Universitaet Osnabrueck,
RL   Barbarastr 11, D 4500 Osnabrueck.
XX
RN   [2]
RX   DOI; 10.1007/BF00273623.
RX   PUBMED; 1851954.
RA   Jahreis K., Postma P.W., Lengeler J.W.;
RT   "Nucleotide sequence of the ilvH-fruR gene region of Escherichia coli K12
RT   and Salmonella typhimurium LT2";
RL   Mol. Gen. Genet. 226(1-2):332-336(1991).
XX
RN   [3]
RP   1-2497
RX   DOI; 10.1006/jmbi.1993.1561.
RX   PUBMED; 8230205.
RA   Ramseier T.M., Negre D., Cortay J.C., Scarabel M., Cozzone A.J.,
RA   Saier M.H.Jr.;
RT   "In vitro binding of the pleiotropic transcriptional regulatory protein,
RT   FruR, to the fru, pps, ace, pts and icd operons of Escherichia coli and
RT   Salmonella typhimurium";
RL   J. Mol. Biol. 234(1):28-44(1993).
XX
DR   MD5; 50e7d1f0f84292fd3a7cde2d9bc4aaee.
DR   EuropePMC; PMC97677; 10816546.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2497
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium"
FT                   /map="3 minutes"
FT                   /strain="LT2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:90371"
FT   CDS_pept        <1..180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilv'I"
FT                   /db_xref="GOA:P40811"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40811"
FT                   /protein_id="CAA39101.1"
FT                   /translation="LQINRPDELESKLSEALEHVRNNRLVFVDVTVDGSEHVYPMQIRG
FT                   GGMDEMWLSKTERT"
FT   prim_transcript <1..>180
FT                   /gene="ilv'I"
FT   regulatory      168..174
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        183..674
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /product="acetolactate synthase II subunit"
FT                   /db_xref="GOA:P21622"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21622"
FT                   /protein_id="CAA39102.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKMEASGYGREEVKRN
FT                   TEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
FT   mat_peptide     183..671
FT                   /gene="ilvH"
FT                   /product="acetolactate synthase II subunit"
FT   prim_transcript <183..>674
FT                   /gene="ilvH"
FT   regulatory      797..823
FT                   /regulatory_class="terminator"
FT   regulatory      891..898
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      918..922
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      947..950
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        958..1962
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /product="PEP:fructose phosphotransferase system repressor"
FT                   /db_xref="GOA:P0A2P8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2P8"
FT                   /protein_id="CAA39103.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDHELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS"
FT   mat_peptide     958..1959
FT                   /gene="fruR"
FT                   /product="PEP:fructose phosphotransferase system repressor"
FT   prim_transcript <958..>2497
FT                   /gene="fruR"
XX
SQ   Sequence 2497 BP; 596 A; 601 C; 684 G; 616 T; 0 other;
     ctgcagatta accgtccgga tgagctggaa agtaaactca gcgaagccct tgagcatgtg        60
     cgtaataacc gactggtgtt cgtcgatgtc accgttgatg gcagcgagca tgtctatccg       120
     atgcagattc gcgggggcgg gatggacgaa atgtggttaa gcaaaacgga gaggacctga       180
     tgatgcgccg gattttatcg gtattactgg aaaacgaatc tggggcgtta tcgcgggtta       240
     tcggcctctt ttcgcaacgc ggatataata ttgaaagcct gaccgtcgcg ccgacagacg       300
     atccgacgtt gtcgcgcatg actatccaga cggtaggcga tgaaaaagtg cttgagcaaa       360
     ttgaaaagca actgcacaag ctggttgatg tgctgcgcgt cagcgagctg ggacagggag       420
     cgcacgttga gcgggaaatc atgctggtga aaatggaggc cagcggctac ggacgggaag       480
     aggtgaagcg taatacggaa attttccgtg gtcagattat tgacgttacg ccaacgctgt       540
     ataccgttca actggcgggc accagcgata aactggatgc ttttctggcc tcgctgcgcg       600
     acgtggcgaa aattgttgaa gtggcgcgtt caggcgtcgt cgggctttcg cgcggcgata       660
     agattatgcg ctgagcagat tcgccggatg acgacgcgcg tgcgttttat ccggtctact       720
     ggctgatatc tggcccaggt ccgataagcg tagcgccatc aggcaggttt gccggatatc       780
     agccaacagg aattatcgcc caacccaata tcatcggttg ggcttttttt tgcgaaatcc       840
     gtggtaaccc ggaataaaag cggttgccgg agtgatcaaa ctgcgcttag atgttaacga       900
     ttttaaccca tgccgacata aaggttatgg tttgtacaat ttacacaagg ggcaattgtg       960
     aaactggatg aaatcgctcg gctggccggt gtctcgcgca caactgcaag ctacgttata      1020
     aacggtaaag caaagcaata ccgcgtgagc gacaaaaccg tagaaaaagt catggcggta      1080
     gtgcgtgagc acaattacca tcctaacgct gtggctgccg ggctgcgtgc tggacgcaca      1140
     cgttccattg gtctggtgat cccggacctt gaaaacacga gctacacccg tatcgcaaac      1200
     tatcttgagc gccaggcacg ccagcgtggc taccaactgc tgatcgcctg ttctgaagat      1260
     cagccggata acgaaatgcg ctgcattgag caccttttgc aacgccaggt ggatgcaatc      1320
     attgtttcaa cttcgttacc gccggagcat cccttctatc agcgctgggc caacgatccg      1380
     ttccccatcg tcgcgctcga ccgcgcgctg gatcgcgaac atttcaccag cgtggtcggc      1440
     gccgatcagg atgatgccga gatgttggcg gaagagctgc gtaaattccc ggcggaaacg      1500
     gtgctttatt tgggcgcgct gccggagttg tccgtcagtt tcctgcgcga gcaggggttc      1560
     cgcaccgcat ggaaagacga tccgcgggag gtgaatttct tatatgccaa cagctatgag      1620
     cgcgaagccg ccgcgcagtt gtttgagaaa tggctggaaa cgcatcctat gccgcaggcg      1680
     ctctttacga catcgttcgc gctattacag ggcgtgatgg acgtaacgct gcggcgcgat      1740
     ggaaaactgc cttcggattt agcgattgcg accttcggcg atcatgagct gctggatttt      1800
     ctgcaatgcc cggtactggc ggtggcgcag cgtcatcgtg atgtcgcgga acgcgtgctg      1860
     gagattgtgc tggcaagtct tgatgaaccg cgtaaaccga aacccggctt aacgcgtatt      1920
     cggcgaaacc tttatcgtcg cggcattctg agccgtagct aaaggaccgg cggtaaaaga      1980
     ctctctcttc tgccgccgtc aaacaaatgc gtatcagtaa aaatatccct taaataatta      2040
     agattattcc ttaaaattat ccgaaaattc ttttttatta cctttctttt gtccgaaatc      2100
     gtccacattc cactaattaa gacgtaacga gtcttttcct ttgtattgtt ttgttacaag      2160
     caggcaagaa atcgtcgaat taacagccac tttttgtctt tggcgcgaca gtcgctcgta      2220
     ggcgctggta tagcaggcac cgcacacgtt aaacaggcac tgttaacacg gtgcaatatg      2280
     tcctaaaatg ccgctcgcgt cgcaaactga cactttatat ttttctcgga ttatattgag      2340
     tccgttttaa acggcggtgg gcctttggtt tttttcttac aaatattcat aacgttaatt      2400
     tggcttgcac gctgggcgga aattaatcaa cgcagatatt cgccgtaaac attggctttt      2460
     ttacttaggt aagcgttgtg acttgcttga caagctt                               2497
//

If you have problems or comments...

PBIL Back to PBIL home page