(data stored in ACNUC23405 zone)

EMBL: X56537

ID   X56537; SV 1; linear; mRNA; STD; HUM; 1254 BP.
XX
AC   X56537;
XX
DT   10-JUL-1991 (Rel. 28, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   Human novel homeobox mRNA for a DNA binding protein
XX
KW   DNA-binding protein; homeobox gene; homeobox protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3] MAT
RA   Kehrl J.H.;
RT   ;
RL   Submitted (30-JAN-1991) to the INSDC.
RL   J.H. Kehrl, National Institutes of Health, Laboratory of Immunoregulation,
RL   9000 Rockville Pike, Bethesda 20892, Maryland, U S A
XX
RN   [2]
RX   DOI; 10.1093/nar/19.13.3742.
RX   PUBMED; 1677181.
RA   Deguchi Y., Kehrl J.H.;
RT   "Nucleotide sequence of a novel diverged human homeobox gene encodes a DNA
RT   binding protein";
RL   Nucleic Acids Res. 19(13):3742-3742(1991).
XX
RN   [3]
RP   1-1254
RA   Kehrl J.H.;
RT   ;
RL   Submitted (16-MAR-1994) to the INSDC.
RL   J.H. Kehrl, National Institutes of Health, Laboratory of Immunoregulation,
RL   9000 Rockville Pike, Bethesda 20892, Maryland, U S A
XX
DR   MD5; 557d3e781249f8ec931991ea7e78e504.
DR   EuropePMC; PMC328407; 1677181.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1254
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /cell_type="B lymphocyte"
FT                   /tissue_type="tonsil"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..716
FT                   /codon_start=3
FT                   /gene="homeobox gene"
FT                   /product="DNA binding protein"
FT                   /db_xref="GOA:Q9UDY3"
FT                   /db_xref="H-InvDB:HIT000322031.12"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UDY3"
FT                   /protein_id="CAA39882.2"
FT                   /translation="GYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQ
FT                   LDQWLRASTAGMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKFNKYLSR
FT                   PKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEE
FT                   PGAEELLGPPAPGDKGSGRRLRDLRDSDPEEDEDEDDEDHFPYSNGASVHAASSDCSSE
FT                   DDSPPPRPSHQPAPQ"
FT   mRNA            1..1204
FT                   /gene="homeobox gene"
FT   misc_feature    208..388
FT                   /note="homeobox"
XX
SQ   Sequence 1254 BP; 244 A; 426 C; 413 G; 171 T; 0 other;
     acggctactc cgcggcggcg gcggcggctg cgctggcggg ccagcacccg gcgctctcct        60
     actcgtaccc gcaggtgcaa ggcgcgcacc ccgcgcaccc cgccgacccc atcaagctgg       120
     gcgccggcac cttccagctg gaccagtggc tgcgcgcgtc caccgcgggc atgatcctgc       180
     ctaagatgcc cgacttcaac tcccaggcgc agtcgaacct cctggggaag tgccgccggc       240
     cgcgcaccgc cttcaccagc cagcagctgc tggagctgga gcaccagttc aagttcaaca       300
     agtacctgtc gcggcccaag cgcttcgagg tggccacctc gctcatgctc accgagaccc       360
     aggtgaagat ttggttccag aaccggcgga tgaaatggaa acgcagcaaa aaggccaaag       420
     agcaggcggc gcaggaagcg gagaaacaga agggcggcgg cgggggcgcg gggaagggcg       480
     gcgcggagga gccgggagcc gaggagctgc tggggccgcc agcgcccgga gacaagggca       540
     gcggacgccg cctgcgggac ttgagggaca gtgaccccga ggaggacgag gacgaggacg       600
     acgaggacca tttcccctac agcaacggcg ccagcgtcca cgccgcctcc tccgactgct       660
     cctcggagga cgactcgccg cccccgcggc ccagccacca gcccgcgccc cagtaggagc       720
     cccgcggccc agcaggtgcg gcgcgcacgg agcgccccgg ccggcggctt ctcccggagg       780
     ccccggcgcc cgcacccacc cggcccggcc ccgagagcag gctcgaccgc cgccccatgg       840
     acccctcgcc caggccgggg ctggagggat tcggccgcgg cctccggtcc tgggcgcttc       900
     ccttttaagc aagggcgcct cacctgctct tcaagaaaca gcgagaggga gacccagggg       960
     gctgaaactt gaactctggt tcttttaaaa ttaattttgg ttggtgttgg gggaggcgcg      1020
     agtgcgtgtg agaagaaccg acccaccccg cgcaagggga agcctcctgt ctcccctttc      1080
     cccgcgtccg agaaggcgga aacccacagt gttacctgac ttatgaaact tgaaaccgcc      1140
     tctggagctg ccattctgca gagtatttgg aaaaagaaaa aagggtttat gcttacgtct      1200
     ctggggtcgg ggggattatg tcacgagcgt tcaaactgct ggaaatctca aaac            1254
//

If you have problems or comments...

PBIL Back to PBIL home page