(data stored in ACNUC11299 zone)

EMBL: X56564

ID   X56564; SV 1; linear; genomic DNA; STD; FUN; 7079 BP.
XX
AC   X56564;
XX
DT   26-FEB-1991 (Rel. 27, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   S. pombe rpb1 gene for the largest subunit of RNA polymerase II.
XX
KW   rpb1 gene.
XX
OS   Schizosaccharomyces pombe (fission yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina;
OC   Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae;
OC   Schizosaccharomyces.
XX
RN   [1]
RP   1-7079
RA   Azuma Y.;
RT   ;
RL   Submitted (09-NOV-1990) to the INSDC.
RL   Y. Azuma, NATIONAL INST OF GENETICS, MISHIMA 1111, SHIZUOKA-KEN 411, JAPAN
XX
RN   [2]
RP   1-7079
RX   DOI; 10.1093/nar/19.3.461.
RX   PUBMED; 2011520.
RA   Azuma Y., Yarnagishi M., Ueshima R., Ishihama A.;
RT   "Cloning and sequence determination of the Schizosaccharomyces pombe rpb1
RT   gene encoding the largest subunit of RNA polymerase II";
RL   Nucleic Acids Res. 19(3):461-468(1991).
XX
DR   MD5; f206b3a79577d367e75e54b5746280ba.
DR   EuropePMC; PMC333634; 2011520.
DR   EuropePMC; PMC535224; 15583292.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7079
FT                   /organism="Schizosaccharomyces pombe"
FT                   /strain="L972 h-"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:4896"
FT   exon            <911..925
FT                   /number=1
FT   CDS_pept        join(911..925,961..986,1027..1099,1139..1214,1260..1319,
FT                   1412..1518,1566..6467)
FT                   /gene="rpb1"
FT                   /product="RNA polymerase II large subunit"
FT                   /db_xref="GOA:P36594"
FT                   /db_xref="InterPro:IPR000684"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007073"
FT                   /db_xref="InterPro:IPR007075"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR038593"
FT                   /db_xref="PDB:3H0G"
FT                   /db_xref="PDB:4PZ6"
FT                   /db_xref="PDB:5U0S"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36594"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAA39916.1"
FT                   /translation="MSGIQFSPSSVPLRRVEEVQFGILSPEEIRSMSVAKIEFPETMDE
FT                   SGQRPRVGGLLDPRLGTIDRQFKCQTCGETMADCPGHFGHIELAKPVFHIGFLSKIKKI
FT                   LECVCWNCGKLKIDSSNPKFNDTQRYRDPKNRLNAVWNVCKTKMVCDTGLSAGSDNFDL
FT                   SNPSANMGHGGCGAAQPTIRKDGLRLWGSWKRGKDESDLPEKRLLSPLEVHTIFTHISS
FT                   EDLAHLGLNEQYARPDWMIITVLPVPPPSVRPSISVDGTSRGEDDLTHKLSDIIKANAN
FT                   VRRCEQEGAPAHIVSEYEQLLQFHVATYMDNEIAGQPQALQKSGRPLKSIRARLKGKEG
FT                   RLRGNLMGKRVDFSARTVITGDPNLSLDELGVPRSIAKTLTYPETVTPYNIYQLQELVR
FT                   NGPDEHPGAKYIIRDTGERIDLRYHKRAGDIPLRYGWRVERHIRDGDVVIFNRQPSLHK
FT                   MSMMGHRIRVMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSEETRAEIQEITMVPKQI
FT                   VSPQSNKPVMGIVQDTLAGVRKFSLRDNFLTRNAVMNIMLWVPDWDGILPPPVILKPKV
FT                   LWTGKQILSLIIPKGINLIRDDDKQSLSNPTDSGMLIENGEIIYGVVDKKTVGASQGGL
FT                   VHTIWKEKGPEICKGFFNGIQRVVNYWLLHNGFSIGIGDTIADADTMKEVTRTVKEARR
FT                   QVAECIQDAQHNRLKPEPGMTLRESFEAKVSRILNQARDNAGRSAEHSLKDSNNVKQMV
FT                   AAGSKGSFINISQMSACVGQQIVEGKRIPFGFKYRTLPHFPKDDDSPESRGFIENSYLR
FT                   GLTPQEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKAMEDVMVRYDGTVRNAMGDIIQ
FT                   FAYGEDGLDATLVEYQVFDSLRLSTKQFEKKYRIDLMEDRSLSLYMENSIENDSSVQDL
FT                   LDEEYTQLVADRELLCKFIFPKGDARWPLPVNVQRIIQNALQIFHLEAKKPTDLLPSDI
FT                   INGLNELIAKLTIFRGSDRITRDVQNNATLLFQILLRSKFAVKRVIMEYRLNKVAFEWI
FT                   MGEVEARFQQAVVSPGEMVGTLAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEI
FT                   LNVAKNIKTPSLTIYLMPWIAANMDLAKNVQTQIEHTTLSTVTSATEIHYDPDPQDTVI
FT                   EEDKDFVEAFFAIPDEEVEENLYKQSPWLLRLELDRAKMLDKKLSMSDVAGKIAESFER
FT                   DLFTIWSEDNADKLIIRCRIIRDDDRKAEDDDNMIEEDVFLKTIEGHMLESISLRGVPN
FT                   ITRVYMMEHKIVRQIEDGTFERADEWVLETDGINLTEAMTVEGVDATRTYSNSFVEILQ
FT                   ILGIEATRSALLKELRNVIEFDGSYVNYRHLALLCDVMTSRGHLMAITRHGINRAETGA
FT                   LMRCSFEETVEILMDAAASGEKDDCKGISENIMLGQLAPMGTGAFDIYLDQDMLMNYSL
FT                   GTAVPTLAGSGMGTSQLPEGAGTPYERSPMVDSGFVGSPDAAAFSPLVQGGSEGREGFG
FT                   DYGLLGAASPYKGVQSPGYTSPFSSAMSPGYGLTSPSYSPSSPGYSTSPAYMPSSPSYS
FT                   PTSPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
FT                   PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY
FT                   SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS"
FT   intron          926..960
FT                   /number=1
FT   exon            961..986
FT                   /number=2
FT   intron          987..1026
FT                   /number=2
FT   exon            1027..1099
FT                   /number=3
FT   intron          1100..1138
FT                   /number=3
FT   exon            1139..1214
FT                   /number=4
FT   intron          1215..1259
FT                   /number=4
FT   exon            1260..1319
FT                   /number=5
FT   intron          1320..1411
FT                   /number=5
FT   exon            1412..1518
FT                   /number=6
FT   intron          1519..1565
FT                   /number=6
FT   exon            1566..>6467
FT                   /number=7
XX
SQ   Sequence 7079 BP; 2024 A; 1386 C; 1394 G; 2275 T; 0 other;
     aagcttctag agccactcct gacattaaag aacagcatgc taagaaaccg aagcgaaagc        60
     acacccgttc aacagtacct acaagcaatg ttgaaccagt ttctcaacct caaccctctc       120
     ctgacaaaat cgtttctagc cccaatccgc catcagcgaa aagggaaaaa aagaaacgtc       180
     gcaaaagctc gatgtcttct tccattacca ctccccctac cgccaaagtt gctaattgag       240
     tttgcttgat aatttcatta attgtgtatt tccttgttcc gaacattaaa gttataggaa       300
     atgattaatt agcaacaagt gtttgcttgt attgctgatt tgagtgtctc tctattatta       360
     ctcaggttgc taatgtctgt aaatattgct tgttaaaaat actggttgtt atataataca       420
     taataatcgt ttttggtcac agcagttgta tataaacgtt taacggcagg cacataatat       480
     ctatattggt tgaaatctat tatagcctta gaataaataa ttagctaaca ggtaattttt       540
     gtttaagttt acattcttcc aatgatcttt ctgctgtata caggaataaa tttatcttcg       600
     ccataaaaag tatcttaatg attttgagaa cttttaattt attgttatga tttccattaa       660
     aaaattttgg agtactatag aatggtgatt gttgtatgca catgtttcaa ataatggtta       720
     actttcatta ttattagata tttataaatc ttgtttatca cagggtggct agtacactaa       780
     taaaaaccta tactgacttt tctgcaccgt gtaacgtaac tcgttatggt catgattacc       840
     gtgaagtagt cctcttgtgt taaattttcg ccgacaccac ctacgactta atctttgcaa       900
     ctcaggtaga atgagcggga ttcaggtatg ttgaacgtat ttaccattac taatacatag       960
     ttttcacctt cttctgtccc cttacggtat gtttctataa gtagtaccgt ttactaacag      1020
     tattagccgg gtggaggagg ttcaatttgg aatcttgtcc ccggaggaaa ttcgttcaat      1080
     gagcgttgcg aagattgagg taagtgtttg ttttgttctt atcacttatc gtttttagtt      1140
     tcctgagacc atggatgaaa gtggacaacg cccccgtgtt ggtgggctcc tggaccctcg      1200
     attggggact attggtatga aattcagaaa aagattagta ttctcacaca ttttgtaaga      1260
     tcgacaattc aagtgtcaaa cctgtggtga aactatggcg gattgtcctg gtcattttgg      1320
     tatgtgttac aactgtttgg tttgttataa aaacaccttt ttttttcagc aaccttctaa      1380
     actcaataaa aagatagcta acacctttca ggtcatattg aacttgcaaa gccagttttc      1440
     cacatcggtt tcctaagcaa aataaaaaaa atattagaat gcgtttgttg gaattgcggc      1500
     aaacttaaga ttgattctgt aagtcaactg ttgagcttat ccattgtgtt actaacatta      1560
     taaagtcaaa tccaaaattt aatgacacac aacgttatcg tgatcccaaa aatcgattaa      1620
     atgcagtttg gaatgtctgc aagacaaaaa tggtttgcga tactggctta tctgcaggct      1680
     cagataattt cgaccttagt aatccctccg ccaatatggg acacggtggt tgtggggctg      1740
     cccaacctac aatacgtaaa gatggcctga gattatgggg ttcttggaaa cgcggtaaag      1800
     atgaatcaga tttaccagaa aaacgccttc tgtcgccgtt ggaggtgcac acaatattca      1860
     cacatatttc ttcagaagat ttagctcact taggtcttaa tgagcagtat gctagacctg      1920
     actggatgat tattacagtc ttacctgttc ctcctccgag tgtccgtcct agtatttcgg      1980
     tggatggaac cagtcgtggc gaagatgatt taacgcacaa actttccgat atcataaaag      2040
     caaatgccaa cgttcgacgg tgtgaacaag aaggagctcc tgcgcatatt gtctctgaat      2100
     atgaacagtt acttcagttc catgttgcca cgtatatgga caatgaaata gcgggacagc      2160
     ctcaggcttt acaaaaatct ggcagacctc ttaaaagtat ccgtgcacgg ctcaagggaa      2220
     aagagggtcg attacgtggc aacctgatgg gtaaacgggt tgatttttca gctcgtactg      2280
     tgattaccgg tgatccaaat ttgtcgttag atgaactcgg tgttccacgt agtattgcta      2340
     agacacttac ttatcctgaa actgttacac cttataatat ttatcaattg caagaattag      2400
     tacgaaatgg tcctgatgag catcccggtg ctaaatatat cattcgtgat acaggagagc      2460
     gtattgactt gcgttatcat aaacgtgctg gtgatattcc tcttaggtac ggttggcgag      2520
     ttgagcggca tattcgtgat ggcgatgtcg ttatttttaa cagacagcca tcccttcaca      2580
     aaatgagtat gatgggtcat aggattcgcg taatgccgta ctcgacattc cgattaaact      2640
     tgtcagttac gtctccttat aatgctgact ttgatggtga tgaaatgaat atgcatgtcc      2700
     ctcagtcaga agaaactcgt gcagaaattc aggaaattac tatggtacct aagcagattg      2760
     tttctcctca atcaaacaag cctgtcatgg gtattgttca agatacttta gcaggtgttc      2820
     gtaagttttc gttacgtgat aactttttga ctcgcaacgc tgtaatgaat attatgttat      2880
     gggtaccaga ctgggatgga atactcccac cacccgtcat tcttaaacca aaggttttat      2940
     ggacaggaaa gcaaattttg agcttgatta tacccaaggg aattaactta attagagacg      3000
     acgataagca aagtctttca aatcccaccg actcaggaat gttgattgaa aatggtgaaa      3060
     ttatatacgg cgtggttgac aagaagactg ttggtgcttc tcaaggtggt ttagttcata      3120
     ctatctggaa agagaaaggt cctgagattt gtaaaggttt cttcaatggt attcaacgag      3180
     ttgtaaacta ttggctttta cataacggtt ttagcattgg tataggagat actattgccg      3240
     atgcggacac aatgaaagag gttactagaa ctgttaagga agcccgtcgt caagtcgcag      3300
     aatgtattca ggatgctcag cacaatcgct taaagcctga gccaggaatg acccttcgag      3360
     aatcttttga agctaaggta tcaaggattc tcaatcaagc gagagacaac gctggtaggt      3420
     cagctgagca tagcttgaag gattctaaca atgtcaaaca aatggttgct gctggttcaa      3480
     aaggttcatt tattaatatc tctcaaatgt ctgcttgcgt cggtcagcaa atcgttgaag      3540
     gcaaacgtat tccttttgga tttaaatatc gtacattacc acattttcct aaagacgacg      3600
     actctccaga atctcgtgga tttattgaaa attcatactt aaggggttta actcctcaag      3660
     agttcttttt ccacgcaatg gctggacgtg agggtttgat tgatactgcg gtcaaaactg      3720
     ctgaaactgg atacatccaa aggcgtcttg ttaaggctat ggaggatgta atggttcgct      3780
     atgacggtac tgtgcgcaat gccatgggtg acattataca atttgcctat ggtgaagatg      3840
     gcctggatgc cacattagta gagtaccagg tttttgactc attaaggtta tccactaagc      3900
     aatttgaaaa gaagtatcga attgatttaa tggaggatag gagtttatca ttgtatatgg      3960
     agaactctat tgagaacgat tcttcagtac aagacttatt agatgaggag tatacacagc      4020
     tggttgctga tcgtgagtta ctatgcaaat ttattttccc caaaggtgat gctagatggc      4080
     ctttacctgt caatgtacaa agaatcatcc aaaatgcttt acaaatattc catttagaag      4140
     ctaaaaaacc caccgatctt ttaccgagtg atattattaa cgggttaaat gaactaattg      4200
     caaaattaac aattttccgc ggaagtgacc gtattactcg tgatgttcaa aacaacgcta      4260
     ccttgttatt ccagatttta ttaaggtcca aatttgctgt aaaacgggta ataatggaat      4320
     accgacttaa caaagtcgca tttgaatgga ttatgggtga agtggaagct cgtttccaac      4380
     aagctgtcgt aagtcctgga gaaatggtgg gtactctggc tgcacaatct attggagaac      4440
     cagcaactca aatgacactc aatacattcc attacgctgg tgtttcttct aagaacgtta      4500
     ccttgggtgt tcctcgtttg aaagaaattt tgaatgtcgc taaaaatatt aagacccctt      4560
     ctttaactat ttatcttatg ccctggatag cagctaatat ggatcttgct aagaacgttc      4620
     aaacccaaat cgaacataca actttgagca ctgttacctc tgcaaccgaa attcattacg      4680
     acccagatcc tcaagacaca gtgattgaag aagataagga ttttgttgaa gctttctttg      4740
     ctattcctga tgaagaagtt gaagagaact tgtataagca gtctccttgg ttgcttcgtc      4800
     ttgaacttga ccgtgctaag atgttagata agaagttgag tatgagtgat gttgctggta      4860
     aaattgctga aagctttgaa cgtgatcttt ttactatttg gtctgaggat aatgcagaca      4920
     agcttatcat tcgttgtcgt atcattcgcg atgatgaccg taaggcagaa gatgacgata      4980
     atatgattga agaggatgtt tttttgaaaa ctattgaagg tcatatgctt gagagtatta      5040
     gtcttcgtgg tgtgccgaac attactcgtg tttatatgat ggagcacaag attgtgcggc      5100
     aaattgaaga tggtactttt gaacgtgctg atgaatgggt tttggaaaca gacggcataa      5160
     atcttactga agcaatgact gtagagggtg tagatgccac cagaacttac tccaattctt      5220
     tcgtggaaat tttgcaaatt cttggtattg aagctacgag atctgcttta cttaaagaat      5280
     taagaaatgt tatcgaattc gatggttctt acgttaatta tcgccatctg gcccttcttt      5340
     gcgatgttat gacatctagg ggccatttaa tggctattac ccgtcatggc attaacagag      5400
     ctgaaaccgg tgctctaatg aggtgctctt ttgaagaaac tgtagaaatc cttatggatg      5460
     ctgctgcgag tggagaaaag gatgattgca agggaatatc tgaaaacata atgctaggac      5520
     aattagcccc aatgggaact ggcgcatttg atatttacct tgatcaagat atgttgatga      5580
     attacagtct tggtaccgcc gtccctacgc tcgctgggtc aggaatgggt acttcccaat      5640
     taccagaagg agccggtacg ccatatgaac gctcaccaat ggttgattct ggatttgttg      5700
     gatctcctga cgccgcagca ttttcccctc tagtacaagg tggatccgaa ggtcgtgaag      5760
     ggtttggcga ttatggattg ttgggggctg ctagtcctta taaaggggta caatcccctg      5820
     gttatactag tccattttcg tctgctatga gtcctgggta tggacttact tcaccaagct      5880
     atagtccatc atctccggga tattccacgt cacctgctta tatgccatcg agtccttcct      5940
     attctccaac tagtccttct tattccccta ctagtccttc ttattcccct actagtcctt      6000
     cctattctcc aacaagtcct tcatactcag cgacaagtcc atcctactct ccaactagtc      6060
     cctcctattc tcctactagt ccttcttatt cgcctacaag cccatcatat tctcctacta      6120
     gtccctctta ttcaccgact agtccttctt attctcccac aagcccatca tattctccta      6180
     ctagtccctc ttattcaccg actagtcctt cttattctcc cacaagtcct tcttattctc      6240
     ctacgagccc atcgtattcg cctactagtc cttcctattc tcctacgagc ccgtcgtatt      6300
     caccgactag tccctcttat tcaccgacta gtccttctta ctctccaact agtccctctt      6360
     attcccctac tagtccctct tattctccta ctagtccttc atattctcct acgagccctt      6420
     cttactctcc cacgagtccc tcgtattccc ctactagccc atcttagcta gttgtgtgaa      6480
     gatgacaatg cttttggtta cgatcgaatg agtcatataa cttgtagttt attgttaact      6540
     attcaatata taaaattttg cactatttta atgttttcta tatagaatga atgtgttgtg      6600
     gttgccgttt agctttggta gtttggtttg tgcgttttgg ttgtctattc aataaaaaca      6660
     atttgacata gctttattta atagtatagt tgatagaaag gtttatgcgc agcactctgt      6720
     ttgattgcct tcattcttgt aatccctatt taaaattaag gacaaatcgg cgacttgttc      6780
     aaataaaaca tcttaatctc ttatttttat aattctaaca aagaatcact aaattcaata      6840
     tattgattga ttctattttt tcagagaaat gaacatatat tcttttacgt ttagtagtaa      6900
     ttgagattat ttgcgttgtg ctaccaatct tttagttcat ataaaattaa aaaaactgga      6960
     agtcaatcta tccaatagta gcatttgtct cataaaaata aaaataatct gaaagatatc      7020
     tttaagtatt ttatgcttat ttgtgattcc aaacacatgc ctactttcaa ttgctgcag       7079
//

If you have problems or comments...

PBIL Back to PBIL home page