(data stored in ACNUC27125 zone)

EMBL: X57546

ID   X57546; SV 1; linear; genomic DNA; STD; FUN; 9588 BP.
XX
AC   X57546;
XX
DT   10-SEP-1991 (Rel. 29, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   K.lactis mitochondrial COX1 and A8 genes for cytochrome oxidase subunit I
DE   and ATPase subunit 8
XX
KW   A8 gene; ATPase subunit 8; coxI gene; cytochrome oxidase subunit 1.
XX
OS   Kluyveromyces lactis
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
OG   Mitochondrion
XX
RN   [1]
RP   1-9588
RA   Hardy C.M.;
RT   ;
RL   Submitted (15-FEB-1991) to the INSDC.
RL   C.M. Hardy, Molecular and Population Genetics Group, Research School of
RL   Biological Sciences, Australian National University, GPO Box 475, Canberra
RL   A.C.T.  2601, Australia
XX
RN   [2]
RP   1-9588
RX   DOI; 10.1007/BF00312772.
RX   PUBMED; 1657415.
RA   Hardy C.M., Clark-Walker G.D.;
RT   "Nucleotide sequence of the COX1 gene in Kluyveromyces lactis mitochondrial
RT   DNA: evidence for recent horizontal transfer of a group II intron";
RL   Curr. Genet. 20(1-2):99-114(1991).
XX
DR   MD5; 77a2481ce1d1f6a8beb7ac6d7920aaca.
DR   EuropePMC; PMC2725318; 19714212.
DR   EuropePMC; PMC96904; 10496929.
DR   RFAM; RF00029; Intron_gpII.
DR   StrainInfo; 586100; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9588
FT                   /organism="Kluyveromyces lactis"
FT                   /organelle="mitochondrion"
FT                   /strain="K8"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:28985"
FT   exon            218..422
FT                   /number=1
FT   CDS_pept        join(218..422,2908..3407,4946..5211,6671..6806,8448..8945)
FT                   /transl_table=3
FT                   /gene="COX1"
FT                   /product="cytochrome oxidase subunit  1"
FT                   /db_xref="GOA:P20386"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20386"
FT                   /protein_id="CAA40765.1"
FT                   /translation="MIERWLYSTNAKDIAVLYFIFAIFCGMAGTAMSLIIRLELAAPGN
FT                   QVLSGNHQLFNVLVVGHAVLMIFFLVMPALIGGFGNYMLPLLIGASDMSFAKMNNISFW
FT                   CLPPALVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAI
FT                   NFIVTTLNMRTNGMTMHRLPLFVWSIFITAFLLLLSLPVLSAGVTMLLLDRNFNTSFFE
FT                   VAGGGDPVLYQHLFGFFGHPEVYILIIPGFGIISHIVSTYSKKPVFGEVSMVYAMASIG
FT                   LLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIYGGSIRLAVPMLY
FT                   AIAFLFLFTIGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQ
FT                   ILGLYYNEKLAQIQFWLIFVGANVIFLPMHFLGVNGMPRRIPDYPDAFAGWNYVASIGS
FT                   IIAVFSLFLFIYILYDQLVNGLENKVNNKSVIYNKGPDFVESNQIFATNKIKSSSIEFL
FT                   LTSPPAVHTFNTPAVQS"
FT   CDS_pept        422..2782
FT                   /transl_table=3
FT                   /note="intron orf"
FT                   /db_xref="GOA:Q34832"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR024937"
FT                   /db_xref="UniProtKB/TrEMBL:Q34832"
FT                   /protein_id="CAA40766.1"
FT                   /translation="CAPFRLIYHCIEVLIDKHISVYSINENFTVSFWFWFLVVTYMEFR
FT                   YVNHMAYSVGANSTGTMACHKSAGVKQPVQGKNCPMARLTNSLQECLGFSLTPSHSGIV
FT                   IHACVLEEEVHELTKNESLTLSKSWHSEGCTSSNGKLRNTGLSERGNPGDNGVFMVPKF
FT                   NLNKVRYFSTLSRLNTRKEDSLTYLTKMNTTDFSELNKLMENNYDNPKTINIRILKLMS
FT                   DIRMLLIAYNKIKSNKGNMSKGSNNITLDGINISYLNKLCKHINTNMFKFSPVRRVEIP
FT                   KTSGGFRPLSVGNPREKIVQESMRMILEIIYNNSFSNYSHGFRPNLSCLTAIVHCKNYM
FT                   KHCNWFIKVDLNKCFDTIPHNMLINVLNERIKDKGFIDLLYKLLRAGYVDKHNNYHHTT
FT                   LGIPQGSVVSPILCNIFLDKLDKYLENKFENEFNTGSMSNRSRNPIYNDLSSKIRRCKL
FT                   LSNKLKLIRLRDHYQRNLGSDKNFKRACFVRYADDIIIGVMGSHDDCKNILNDMNNFLK
FT                   ENLGMSINMDKSIIKHSKEGVSFLGYDVKVTPWEMRPYRMIKRGDKFIRVRHHTSLVVN
FT                   APIRSIVMKLNKNGYCSQGIVGKPRGVGRLIHEEMKTILMHYLAVGRGIMNYYRLATNF
FT                   TTLRGRITYILFYSCCLTLARKFKLNTVKKVILKFGKVLIDPNSKVSFGIDDFKIRHKM
FT                   NMTDSNYTPDEILDRYKYMLPRSLSLFSGICQVCGSKQNLEVHHVKMLNNAANKIKNDY
FT                   LLGRMIKMNRKQITICKTCHFKIHQGKYNGPGL"
FT   intron          423..2907
FT                   /number=1
FT   exon            2908..3407
FT                   /number=2
FT   CDS_pept        3408..4409
FT                   /transl_table=3
FT                   /note="intron orf"
FT                   /db_xref="GOA:Q34833"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:Q34833"
FT                   /protein_id="CAA40767.1"
FT                   /translation="FSMPFYMVIYDYKYNINLWLSSFKNLEFNQDKFYFDEFNLKYKEF
FT                   KPMNSVPDQKFLEWFVGFFEGKGSFILMKRSDISVVVTSKDMKILNYIKNNFNMGDVIL
FT                   QSKKDMTYRWVVHKRRDIYLLSLIFNGNLVLPTRYGKFMIFLAKLNEKLLKNNEPMIIL
FT                   KNYCKLPTLNDYWLSGFTDAEGCFDISLKDNKNTPRFLYALVKNMLFNKYVLEHILNLF
FT                   IDKSNTNSLYNINSEKNIGKVYSNSKDDNWQLWISGLNNCIFILNYFKEYPLLSDKSNS
FT                   LDKFIHVMNYYKQNKPLNEEQKLYIKKMSKPCATSPDPHKGLGESRRELINK"
FT   intron          3408..4945
FT                   /number=2
FT   exon            4946..5211
FT                   /number=3
FT   intron          5212..6670
FT                   /number=3
FT   CDS_pept        5213..6172
FT                   /transl_table=3
FT                   /note="intron orf"
FT                   /db_xref="GOA:Q34834"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:Q34834"
FT                   /protein_id="CAA40768.1"
FT                   /translation="MNSFSKSIKLIKKYMKYMYINNNHNNNNNNNNPRGQSPVIGNMTA
FT                   GMNKIYNNNSYNSYNNNNNYYNKKLTIYGTNLYSNLMNKEYNNTMMIKYMIKIPNNIMY
FT                   MINGILLTDGWIEYSSKNTLINSRLKFKQTLKQVEYVLYVYNKLNHYCVSPPKLIKTPR
FT                   GSSPGNPRGGVRGERLKGKIYYGVEMTTMALPCFTKLRHQFYNGRVKIMPNDLYDLLNY
FT                   ESLAHIIMGDGSFNKGGGITLNLQSYTIKELIYFINILKIKFNLDCTLHKHKSYYVIYI
FT                   KVKSIKLLYPNIKNYIIPSMKYKFEYKLLQKYDKYNNK"
FT   exon            6671..6806
FT                   /number=4
FT   CDS_pept        6807..7991
FT                   /transl_table=3
FT                   /note="intron orf"
FT                   /db_xref="GOA:Q34835"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:Q34835"
FT                   /protein_id="CAA40769.1"
FT                   /translation="KMNIMIIMLYISYIYTYPFSNGKYCNLYNPTTFYKINNILYSIKM
FT                   YNINNNTNNTNNNNPADSSSYESRMRAAGNSNSNSNSNSDSNINNTNNINNTNNIYNIN
FT                   NNINNNNNINNNYINNSIPCGSYPQGRWTAGSEFYKMLFVGLFDSNGNIQINKYKSKYL
FT                   QFRLIIKLNNNKENINMLNNIKHYLKGNININNNYVMWIMNDMKNINNLIKLFNKYPLM
FT                   TMNKKLQLAFMKSMYYIYKNNRNLAMNLYLKDRNNKYNPNLYKYYKDMNYTKINYFSPA
FT                   NFHKKFAGININININNNYNHNYINVWFLGFIENKGKFIIRKNNNNSFLFYMNDKHLME
FT                   FLKNYFNIKNKLMYKNNMYILEVYNKYYINMFIKFFNKYNLQGYKYIEYIKWKK"
FT   intron          6807..8447
FT                   /number=4
FT   exon            8448..8945
FT                   /number=5
FT   CDS_pept        9301..9447
FT                   /transl_table=3
FT                   /gene="A8"
FT                   /product="ATPase subunit 8"
FT                   /db_xref="GOA:Q00608"
FT                   /db_xref="InterPro:IPR009230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00608"
FT                   /protein_id="CAA40770.1"
FT                   /translation="MPQLVPFYFLNQLVYGFALVTILLVLFAQYFLPQILRLYVSRLFI
FT                   SKL"
XX
SQ   Sequence 9588 BP; 3749 A; 1033 C; 1223 G; 3583 T; 0 other;
     gcgcgggggt aacgaattta tctataatta tataattata ataataatta tatataacta        60
     attaattaat taataataaa aaacataatg tatattacat actaatcccc gcggctcccc       120
     cccttcaggg ggggagccgc gggtaaatat aactaataat aatagtttat tatattatat       180
     attttaaata taatataata attataaaaa taaattaatg atcgaaagat gattatattc       240
     tacaaatgct aaagatattg ctgttttata ctttatcttt gctattttct gtggtatggc       300
     aggtactgcc atgtctttaa tcattagatt agagttagcc gcaccaggta atcaagtttt       360
     aagcggaaat catcaattat ttaatgtctt agtagttggg catgcggtct taataatttt       420
     ctgtgcgccg tttcgcttaa tttatcactg tattgaagtg ttaattgata aacacatctc       480
     tgtttattca atcaatgaaa actttaccgt atcattttgg ttctgattct tagtagtaac       540
     atacatagaa tttagatacg taaaccatat ggcttactca gttggggcca actcaacggg       600
     gacaatagca tgccataaaa gcgctggagt aaaacagcca gtgcaaggta agaactgtcc       660
     gatggctagg ttaacgaact ccttacaaga atgtttaggg ttctcattaa ctccttccca       720
     ctcggggatt gtgattcatg cttgtgtatt ggaagaagag gtacacgagt taaccaaaaa       780
     tgaatcatta actttaagta aaagttgaca ttcggagggc tgtacgagtt caaatggtaa       840
     attaagaaat acgggattgt ccgaaagggg aaaccctggg gataacggag tcttcatagt       900
     acccaaattt aatttaaata aagtgagata ttttagtact ttatctagat taaatacaag       960
     gaaggaagac agtttaacgt atttaacaaa gataaatact acggattttt ctgagttaaa      1020
     taaattaata gaaaataatt atgataatcc aaaaaccatt aatattagaa ttttaaaatt      1080
     aatgtcagat attagaatgt tattaattgc ttataataaa attaaaagta ataaaggtaa      1140
     tatatctaaa ggttctaata atattacctt agatggaatt aatatttcat atttaaataa      1200
     attatgtaaa catattaata ctaatatgtt taaattttct cctgttagaa gagttgaaat      1260
     tcctaaaaca tctggaggat ttagaccttt aagtgttggt aatcctagag aaaaaattgt      1320
     acaagaaagt atgagaataa ttttagaaat tatttataac aatagttttt ctaattattc      1380
     tcatggtttt agaccaaact tatcttgttt aacagctatt gttcactgta aaaattatat      1440
     gaaacactgt aattgattta ttaaagtaga tttaaataaa tgttttgata caattccaca      1500
     taatatgtta attaatgtat taaatgaaag aatcaaagat aaaggtttca ttgatttatt      1560
     atataaatta ttaagagctg gatatgttga taaacataat aattatcatc atacaacttt      1620
     aggaattcct caaggtagtg ttgtcagtcc tattttatgt aatattttct tagataaatt      1680
     agataaatat ttagaaaata agtttgagaa tgaattcaat actggatcta tgtctaatag      1740
     aagtagaaat ccaatttata atgatttatc atctaaaatt agaagatgta aattattatc      1800
     taataaatta aaattgatta gattaagaga ccattaccaa agaaatttgg gatctgataa      1860
     aaactttaaa agagcttgtt ttgttagata tgctgatgat attatcattg gtgtaatggg      1920
     ttctcatgat gattgtaaaa atattttaaa cgatataaat aatttcttaa aagaaaattt      1980
     aggtatgtct attaatatag ataaatccat tattaaacat tctaaagaag gagttagttt      2040
     tttagggtat gatgtaaaag ttacaccttg agaaataaga ccttatagaa tgattaaaag      2100
     aggtgataaa tttattaggg ttagacatca tactagttta gttgttaatg cccctattag      2160
     aagtattgta ataaaattaa ataaaaatgg ttattgttct caaggaattg taggaaaacc      2220
     cagaggggtt ggaagattaa ttcatgaaga aatgaaaacc attttaatgc attacttagc      2280
     tgttggtaga ggtattataa actattatag attagctacc aattttacca cattaagagg      2340
     tagaattaca tacattttat tttattcatg ttgtttaaca ttagcaagaa aatttaaatt      2400
     aaatactgtt aagaaagtta ttttaaaatt cggtaaagta ttaattgatc ctaattcaaa      2460
     agtaagtttt ggtattgatg attttaaaat tagacataaa ataaatataa ctgattctaa      2520
     ttatactcct gatgaaattt tagatagata taaatatatg ttacctagat ctttatcatt      2580
     atttagtggt atttgtcaag tttgtggttc taaacaaaat ttagaagtac atcatgtaaa      2640
     aatattaaat aatgctgcca ataaaatcaa aaatgattat ttattaggta gaatgattaa      2700
     gataaataga aaacaaatta ctatctgtaa aacatgtcat tttaaaattc atcaaggtaa      2760
     atataatggt ccaggtttat aataattatt ttaaactatt aaacatgcgc taaacggaga      2820
     gccgtatgat atgaaagtat cacgtacggt tcggagaggg ctctcttata tgattgttat      2880
     tacaatcaga taggtttgct actctactct tagtaatgcc ggcattaatt ggtggttttg      2940
     gtaactatat gttaccttta ttaattggag catcagatat gtcttttgca aagataaata      3000
     atatttcatt ctgatgttta ccacctgctt tagtatgttt agtaacttct acattagtag      3060
     aatctggtgc aggtactgga tgaactgtat atcctccatt atcatcaatt caagcacatt      3120
     caggacctag tgttgattta gcaatttttg ctttacattt aacatctatt tcatcattat      3180
     taggtgctat taatttcatt gtaaccacat taaatatgag aacaaatggt atgacaatgc      3240
     atagattacc attatttgta tgatctattt tcattacagc attcttatta ttattatcat      3300
     tacctgtatt atcagcaggt gttacaatgt tattattaga tagaaacttc aatacttcat      3360
     tcttcgaagt agcaggtggt ggtgaccctg ttttatacca acatttgttt tctatgccat      3420
     tttatatagt aatttatgat tataaatata atattaattt atgattatct tcatttaaaa      3480
     atttagaatt taatcaagat aaattttatt ttgatgaatt taatttaaaa tataaagaat      3540
     ttaaacctat aaattctgtt cctgatcaaa aatttttaga atgatttgta ggattttttg      3600
     aaggtaaagg ttcatttatt ttaataaaaa gaagtgatat ttctgttgtt gtaacttcta      3660
     aagatataaa aattttaaat tatattaaaa ataattttaa tataggagat gtaattttac      3720
     aatctaaaaa agatataaca tatagatgag tagtacataa aagaagagat atttatttat      3780
     tatcattaat ttttaatggt aatttagtat tacctactag atatggtaaa tttataattt      3840
     ttttagctaa attaaatgaa aaattattaa aaaataatga acctataatt attttaaaaa      3900
     attattgtaa attacctact ttaaatgatt attgattatc tggatttact gatgctgaag      3960
     gttgttttga tatttcttta aaagataata aaaatacacc tagattttta tatgcattag      4020
     tcaaaaacat attgtttaat aaatatgtat tagaacatat tttaaattta tttattgata      4080
     aatctaatac taattcatta tataacatta atagtgaaaa aaatattggt aaagtttatt      4140
     ctaattctaa agatgataat tgacaattat gaatttcagg attaaataat tgtattttta      4200
     ttttaaatta ttttaaagaa tatcctttat tatctgataa atctaatagt ttagataaat      4260
     ttattcatgt aataaattat tataaacaaa ataaaccttt aaatgaagaa caaaaattat      4320
     atattaaaaa aatatctaaa ccctgcgcga catcacccga ccctcataaa gggttgggtg      4380
     agtcgcgcag ggaattaatt aataaataat catattttat tagtataaat aaaaaatatt      4440
     gaaacaaagg aaatagttta acttaagtta attagaaaag atataacaat gttgatatga      4500
     aaaataaaaa gattatatct ctcttaatat atatatataa attaagagac taaatattta      4560
     ttattctctt attcggacac catccaaggg atttaccttt tttaataccc cccccatatc      4620
     ttcttcccag ctaagctgat aagaagatat gggtagaaga gataaatata ctattttcta      4680
     gtattatata tatattatat aatgcaacat tggtggtacg gtcaacattt ctcagattta      4740
     gaccgtcggt tataatatat ataattatat attctgatcg ctacagactg cttcaccaat      4800
     gggtgatata ataatattgc ttatgtacag tcggaatcac ttattaataa taaggtcata      4860
     tattatatat gagatatata ttatagagtc tacccgtgct attatcaaaa ataatatttg      4920
     gggaaaagat aatatattat ttagatttgg attctttggt caccccgaag tttatatttt      4980
     aattattcct ggattcggta ttatttcaca tatcgtatca acttattcta aaaaaccagt      5040
     attcggtgaa gtatcaatgg tatatgctat ggcttcaatt ggattattag gtttcttagt      5100
     atgatcacat catatgtata ttgtaggatt agatgcagat actagagctt atttcacatc      5160
     ggctacaatg attattgcaa ttcctacagg tattaaaatt ttctcatgat taataaactc      5220
     ctttagcaag agtattaagt tgatcaaaaa atatataaaa tatatatata ttaataataa      5280
     tcataataat aataataata ataataatcc ccgcggtcag tcaccggtta tcggtaacat      5340
     gaccgcgggg ataaataaga tttataataa taattcttat aattcttata ataataataa      5400
     taattattat aataaaaaat taacaattta tggtactaat ttatattcaa atttaataaa      5460
     taaagaatat aataatacta taataattaa atatataatt aaaattccaa ataatattat      5520
     atatataatt aatggaattt tattaacaga tggttgaatt gaatatagtt caaaaaatac      5580
     attaattaat agtagattaa aatttaaaca aactttaaaa caagtagaat atgttttata      5640
     tgtatataat aaattaaatc attattgtgt aagtcctcca aaattaatta aaacaccccg      5700
     cggctcctcc cctggtaatc ccaggggagg agtccgcggg gaaagattaa aaggtaaaat      5760
     ttattatgga gttgaaataa ctactatagc tttaccttgt tttactaaat taagacatca      5820
     attttataat ggtagagtaa aaattatacc aaatgattta tatgatttat taaattatga      5880
     atcattagct catattatta taggagatgg ttcatttaat aaaggtggag gtattacatt      5940
     aaatttacaa tcatatacta ttaaagaatt aatttatttt attaatattt taaaaattaa      6000
     atttaattta gattgtactt tacataaaca taaatcatat tatgttattt atattaaagt      6060
     taaatctatt aaattattat atcctaatat taaaaattat attattccat ctataaaata      6120
     taaatttgaa tataaattat tacaaaaata tgataaatat aataataaat aatatatccc      6180
     cgcggattca taatatgaat ccgcggggta atatatataa tctatataat atatatataa      6240
     tttatatatt aagaagcaaa ctcgagagaa atcctatata tataaattag aatttatata      6300
     gggcaatcgt cgaactaaat tatatataag aaattatata tataaaagcg tagagatcag      6360
     atgcttctgg tatttctaag taatatattc cccgcaaaat atttcctgca ggaaatattt      6420
     tgcggtctat tatatgaata cataaggaat gatccaatgg aactagtaat agttttgaag      6480
     caatccttca aataatatat atatgattat atatatatta tcctaatata tatagttacc      6540
     caatatcctc caaatatttg gaggatattg ggattaataa taaataatta tatataaatt      6600
     taactagcta ttataatatt tattataaat attataaatg aatctgtgat gatttaaggt      6660
     taaaaataag agcaacaatt tatggtggat caattagatt agctgtacct atgttatatg      6720
     ctattgcttt cttattctta ttcacaattg gtggattaac aggagtagca ttagcaaatg      6780
     catcattaga tgtagcattc catgataaaa taaatattat aattattata ttatatattt      6840
     catatattta tacttatccc ttctctaatg ggaaatactg taatttatat aatcctacca      6900
     cattttataa aattaataat attttatact ctattaaaat atataatatt aataataata      6960
     ctaataatac taataataat aaccccgcgg actcatcatc ctacgaaagt agaatgagag      7020
     ccgcggggaa tagtaatagt aatagtaata gtaatagtga tagtaatatt aataatacta      7080
     ataatattaa taatactaat aatatttata atattaataa taatattaat aataataata      7140
     atattaataa taattatatt aataatagta ttccctgcgg ttcatatcca caaggaagat      7200
     gaaccgcagg gtcagaattc tataaaatgt tatttgtagg attatttgat agtaatggta      7260
     atattcaaat taataaatat aaatctaaat atttacaatt tagattaatt attaaattaa      7320
     ataataataa agagaatatt aatatattaa ataatattaa acattattta aaaggtaata      7380
     ttaatattaa taataattat gtaatatgaa ttataaatga tataaaaaat attaataatt      7440
     taattaaatt atttaataaa tatccattaa taactataaa taaaaaatta caattagcat      7500
     ttataaaatc tatatattat atttataaaa ataatagaaa tttagcaata aatttatatt      7560
     taaaagatag aaataataaa tataatccta atttatataa atattataaa gatataaatt      7620
     atactaaaat taattatttt tcccccgcga acttccataa aaagttcgcg ggaattaata      7680
     ttaatattaa tattaataat aattataatc ataattatat taatgtatga tttttaggtt      7740
     ttattgaaaa taaaggtaaa tttattatta gaaagaataa taataattca tttttatttt      7800
     atataaatga taaacattta atagaattct taaaaaatta ttttaatatt aagaataaat      7860
     taatatataa aaataatata tatattttag aggtatataa taaatattat attaatatat      7920
     ttattaaatt ttttaataaa tataatttac aaggttataa atatattgaa tatattaaat      7980
     gaaaaaaata aatatttaaa ggtgtcatgt aggtaaattc acctacttaa ttatctttaa      8040
     tacccccccc caacccctat aaggtgttgg gggggggatg gatatattaa ggggttatat      8100
     ttttttttaa taaatatagc taacgaagaa atcttatata aataaattta atgtaattta      8160
     tatacctaca attatataag acaatttcgt ggtaaccatt attatatttt atataataat      8220
     gggaactgta gagactatac gtgaataata atatataatt atcaatatat atataatata      8280
     tataatatgt attatatttc ccgcgaattt cccttaaagt ggaattcgcg ggatacatat      8340
     attggttata tattattaag acatagtcca atcctttatg taaataaaga atataaaccc      8400
     cggacggcat cgtccgaccg tatggtcgga cgagccgtcc ggggaagact tattatgtag      8460
     taggacattt ccattatgta ttatcaatgg gtgctatttt ctcattattt gcaggatatt      8520
     attactgaag tcctcaaatt ttaggattat attataatga aaaattagca caaattcaat      8580
     tctgattaat ttttgtagga gctaatgtta ttttcttacc tatgcatttc ttaggagtaa      8640
     atggtatgcc tagaagaatt cctgattatc ctgatgcttt tgcaggttga aattatgtag      8700
     cttcaattgg ttcaattatt gctgtattct cattattctt atttatctat attttatatg      8760
     atcaattagt taatggatta gaaaataaag ttaataataa atcagtaatt tataataaag      8820
     gacctgattt tgttgaatca aatcaaatct tcgcaactaa taaaattaaa tcttcatcaa      8880
     ttgaattctt attaacttct ccaccagctg ttcatacatt taatactcca gctgtacaat      8940
     cataataatt atattattat cttttttaat attcttttta taaatatgac ccccccccgc      9000
     ggctacgata tatgtcgtag ccgcggggtg aaagattatt cttaatagta cacccttata      9060
     atacatagaa ttataaggat gatttatata caatatatat aatattatat tatatatata      9120
     tattcatata tatacttttt ttatataaat attagtccta ataatcccgc ggaatccttc      9180
     agatatctga ggtattccgc ggggaaggat taatattatt aatatataat aattttatat      9240
     aattatatta atattaataa taatattaat agtaaattat aatttaatat aaaaataaat      9300
     atgccacaat tagtaccatt ttatttctta aatcaattag tatatggttt tgcattagtt      9360
     actattttat tagtattatt tgcacaatac ttcttaccac aaattttaag attatatgta      9420
     tcaagattat ttatttcaaa attataatta tacatatatc attttccccg cgaattacgg      9480
     tctataccgt aattcgcggg gttcatatta tttataataa taatatgttt ccctaaaatt      9540
     ttatattgaa atttacggga tttataatta atatatatta ctgcggcc                   9588
//

If you have problems or comments...

PBIL Back to PBIL home page