(data stored in ACNUC1104 zone)

EMBL: X58833

ID   X58833; SV 1; linear; genomic DNA; STD; PRO; 5400 BP.
XX
AC   X58833; S75682;
XX
DT   14-JAN-1992 (Rel. 30, Created)
DT   12-JUN-2006 (Rel. 88, Last updated, Version 7)
XX
DE   S.coelicolor 6 actVA region genes of the actinorhodin biosynthetic gene
DE   cluster
XX
KW   actinorhodin biosynthesis; actVA gene.
XX
OS   Streptomyces coelicolor
OC   Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
OC   Streptomyces; Streptomyces albidoflavus group.
XX
RN   [1]
RP   1-5400
RA   Caballero J.L.;
RT   ;
RL   Submitted (09-APR-1991) to the INSDC.
RL   J.L. Caballero, Dept of genetics, John Innes Inst, Colney Lane, Norwich NR4
RL   7UH, UK
XX
RN   [2]
RX   DOI; 10.1007/BF00280297.
RX   PUBMED; 1766437.
RA   Caballero J.L., Martinez E., Malpartida F., Hopwood D.A.;
RT   "Organisation and functions of the actVA region of the actinorhodin
RT   biosynthetic gene cluster of Streptomyces coelicolor";
RL   Mol. Gen. Genet. 230(3):401-412(1991).
XX
DR   MD5; f0c1db601f75597607a55e954f8b1658.
DR   EuropePMC; PMC4847265; 27118214.
DR   EuropePMC; PMC94324; 10633095.
DR   EuropePMC; PMC98904; 9529885.
DR   EuropePMC; PMC99040; 11729263.
DR   StrainInfo; 684630; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5400
FT                   /organism="Streptomyces coelicolor"
FT                   /strain="A3(2)"
FT                   /mol_type="genomic DNA"
FT                   /clone="pIJ2323"
FT                   /db_xref="taxon:1902"
FT   CDS_pept        19..1620
FT                   /transl_table=11
FT                   /gene="actVA 1"
FT                   /db_xref="GOA:Q53903"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q53903"
FT                   /protein_id="CAA41637.1"
FT                   /translation="MTANPGRPGGPADQGHPRRWAILGVLVLSLVGIILDNTVLNVTLR
FT                   TLTDPEQGLGASHSQVEWVLSAYTLAFAATLFTWGVLGDRLGRRRVLLLGLGLFGLSSL
FT                   AGAYAGSPEQLIAARACMGVSGAAVLPSTLATIAAVFPLRERPKALGIWAASVGFALGI
FT                   GPVTGGILLAHFWWGSVLLVNVPLMAGCLVAVVLVVPETRGTAGRRVDAAGLLLSIAGV
FT                   VPLVYAIIEAGRSGGVTRPAVWAAGLAGLGLLLVFLWHERRTPEPSLELGFFRMKAFST
FT                   AVAAVGFVSFAMMGFLFFSAFYLQSVRGYTPLQAGGCTVALAVANVVCGPLSTVLVRSI
FT                   GPRNVCAAGMLAVTASLCGVTFVTQHAPVWLILVLFAALGAGVACVMPTAAVSIMNAIP
FT                   REKAGVASAMNNTVRQLGGALGVAVLGSLMGAAYRRGIEDELAVLPPSARHQAGESLDA
FT                   TLLAATRLGESGLVGPARQAFLDAMHLAAGAAAAVALVGALAVLRWLPSSVTTPTPPAG
FT                   AVPGREHSDHLKVQGS"
FT   CDS_pept        1622..2017
FT                   /transl_table=11
FT                   /gene="actVA 2"
FT                   /db_xref="GOA:Q53904"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024031"
FT                   /db_xref="UniProtKB/TrEMBL:Q53904"
FT                   /protein_id="CAA41638.1"
FT                   /translation="MPFTPDELEYYASQNLGRLATVAPDGQPQANPVSFRVNTETGTID
FT                   IGGHNLTASKKFRNVTKHDQVAFVVDDLISTQPWNVRGIEVRGRAEALTDAHAPHPYFG
FT                   TAMIRIHPKRIITWGLGGDAAQRGRDV"
FT   CDS_pept        2112..2957
FT                   /transl_table=11
FT                   /gene="actVA 3"
FT                   /db_xref="UniProtKB/TrEMBL:Q53905"
FT                   /protein_id="CAA41639.1"
FT                   /translation="MSTEIFHEEFAGGLVTEGPGAPWRLRPVDGLEAGDGLVRGGPDGL
FT                   VVVPSAAHPGTRRPAFTEPKPGPDGTPLHLRWGAFTTGGTTGGTAGARAAFTAVPGERL
FT                   SVRAEMGLRGFGLRSHPYDDVTEPDADARLGAGGLISVDLESGIIFDFFLTHSRLYAVY
FT                   ERLALRPDAEFAAFTSCVPVADRTPGTLHRLEVGYDVAAGTAHWTADGQEVLSVDRIGF
FT                   RALDARWLRRDNGGREEAVRPRGLSFGLGLFLERHFGQGVRLSVRRLSVLTSPAGSRDS
FT                   "
FT   CDS_pept        2982..3866
FT                   /transl_table=11
FT                   /gene="actVA 4"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q53906"
FT                   /protein_id="CAA41640.1"
FT                   /translation="MPDENKPVLVLGATGKQGGSAARYLLERGWTVRAFVRDPGAPKAK
FT                   ELRELGASLHTGDLEDAGSVRAAMKGAYGVFSIQTPMTPAGVEGEERQGKICADAARDL
FT                   GVQHYVHSSVGGAERPEGVNWRLSKLAIEQRIQENALRFTFLRPSYFMENLNHDMSPLV
FT                   MEDGVLTFRRGLGPANTLQMISGPDIGYFAADAFDDPDTFGGAKIELAGDELTGEQIAA
FT                   AFGRHTGLPARFVSVPIPELHRTGFEWQAISYTWLNGIGYHADIPTLRARFPQLLTLDQ
FT                   WLARTGWTPRDPA"
FT   CDS_pept        3863..5008
FT                   /transl_table=11
FT                   /gene="actVA 5"
FT                   /db_xref="GOA:Q53907"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q53907"
FT                   /protein_id="CAA41641.1"
FT                   /translation="MSEDTMTQERPSLTAHARRIAELAGKRAADAEQQRRLSPDVVDAV
FT                   LRAGFAAHFVPVAHGGRAATFGELVEPVAVLGEACASTAWYASLTASLGRMAAYLPDEG
FT                   QAELWSDGPDALIVGALMPLGRAEKTPGGWHVSGTWPFVSVVDHSDWALICAKVGEEPW
FT                   FFAVPRQEYGIVDSWYPMGMRGTGSNTLVLDGVFVPDARACTRAAIAAGLGPDAEAICH
FT                   TVPMRAVNGLAFALPMLGAARGAAAVWTSWTAGRLAGPTGQNAVSSQDRVVYEHTLARA
FT                   TGEIDAAQLLLERVAAVADAGSATGVLVGRGARDCALAAELLTAATDRLFASAGTRAQA
FT                   QDSPMQRLWRDVHAAGSHIGLQFGPGAALYAGELLRRSNDG"
FT   CDS_pept        5001..5342
FT                   /transl_table=11
FT                   /gene="actVA 6"
FT                   /db_xref="GOA:Q53908"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="PDB:1LQ9"
FT                   /db_xref="PDB:1N5Q"
FT                   /db_xref="PDB:1N5S"
FT                   /db_xref="PDB:1N5T"
FT                   /db_xref="PDB:1N5V"
FT                   /db_xref="UniProtKB/TrEMBL:Q53908"
FT                   /protein_id="CAA41642.1"
FT                   /translation="MAEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPG
FT                   FLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFM
FT                   TPRGAILPS"
XX
SQ   Sequence 5400 BP; 712 A; 1963 C; 1955 G; 770 T; 0 other;
     cgtcctggtg ccggacctgt gacggcgaac cccggccgtc cgggcggccc ggcggaccag        60
     ggccacccgc gccgctgggc catcctcggg gtgctggtcc tcagcctggt cggcatcatc       120
     ctcgacaaca ccgtgctcaa cgtgacgctg cgcaccctca ccgaccccga gcagggcctg       180
     ggcgcctcgc acagccaggt ggaatgggtg ctcagcgcct acaccctggc cttcgcggcg       240
     acgctgttca cctggggagt gctgggcgac cgactgggcc gcaggcgggt actcctgctg       300
     ggcctcggcc tgttcggact gtcgtccctg gccggggcct acgccgggtc gccggagcag       360
     ctcatcgccg cccgtgcctg catgggggtg agcggcgcgg cggtgctgcc gagcacactc       420
     gccaccatcg ccgccgtctt cccgctgcgc gagcggccca aggccctcgg gatctgggcg       480
     gcctcggtcg gcttcgccct cggcatcggg cccgtcaccg gcgggatact gctcgcgcac       540
     ttctggtggg gctcggtcct gctggtcaac gtgcccctca tggccgggtg cctggtcgcg       600
     gtggtgctgg tggtgcccga gacccggggc acggcgggca ggcgcgtcga cgcggccgga       660
     ctgctgctct cgatcgcggg tgtcgtgccg ctcgtctacg cgatcatcga ggccggccgg       720
     agcggcgggg tcacccggcc cgcggtctgg gcagccggcc tggcgggcct cggcctgctc       780
     ctcgtgttcc tgtggcacga gcgccgtacc ccggaaccct cgctggagct cggcttcttc       840
     cggatgaagg ccttctccac cgccgtcgcg gccgtcggct tcgtcagctt cgcgatgatg       900
     ggcttcctct tcttcagcgc cttctacctg cagagcgtgc gcggctacac acccctgcag       960
     gccgggggat gcaccgtggc actggccgtc gcgaacgtgg tctgcggacc gctcagcacg      1020
     gtcctggtgc gttcgatcgg cccccggaac gtgtgcgcgg cgggcatgct ggccgtcacc      1080
     gcatcgctct gcggggtcac cttcgtgacc cagcacgcac ccgtatggct gatcctcgtc      1140
     ctgttcgccg cgctgggggc gggcgtagca tgcgtcatgc cgaccgcggc cgtgtccatc      1200
     atgaacgcga tcccacgcga gaaggcgggc gtcgcctcgg cgatgaacaa caccgtgcgc      1260
     cagctgggcg gcgccctggg cgtcgcggtg ctcggttccc tcatgggcgc cgcgtaccgc      1320
     cgcggcatcg aggacgagct cgccgtactg ccgccctccg cgcggcacca ggccggcgag      1380
     tccctggatg ccaccctgct ggccgcgact aggctggggg agagcggact tgtcggcccc      1440
     gcgcgccagg cattcctgga cgccatgcac ctggccgccg gggccgctgc cgcggtggcg      1500
     ctcgtggggg cccttgccgt gctccgctgg ctgccctcct ccgtcacgac tccgacgccc      1560
     ccggcagggg ccgtgcccgg ccgggagcat tccgatcacc tcaaggtcca aggaagctga      1620
     catgcctttc actcctgacg agctcgagta ctacgcctcc cagaacctcg gccggctggc      1680
     caccgtggcg cccgacggcc agccccaggc caacccggtc tcgttccgcg tcaacaccga      1740
     gaccggcacg atcgacatcg gcgggcacaa cctgaccgcc agcaagaagt tccgcaacgt      1800
     caccaagcac gaccaggtcg ccttcgtcgt cgacgacctg atctccacgc agccgtggaa      1860
     cgtacgcggt atcgaagtgc gcggccgggc cgaggcgctg accgacgcgc acgcgccgca      1920
     cccctacttc ggtaccgcga tgatccgtat ccaccccaag cgcatcatca cctggggcct      1980
     cggcggcgac gccgcccagc gcggccgcga cgtctgaccc agcacccttc gactccgctt      2040
     cgagcggacc tcgacgccct cttgccaagg tggagcccgt aggacgggta caccacgggg      2100
     agggcggctg gatgagtaca gagatcttcc atgaggagtt cgccgggggg ctggtgaccg      2160
     aggggccggg cgcgccgtgg cggcttcgcc cggtcgacgg tctcgaggcg ggagacgggc      2220
     tggtccgcgg gggaccggac ggcctggtgg tcgtgccgag cgccgcccac ccggggaccc      2280
     ggcggccggc gttcaccgag cccaagcccg ggccggacgg caccccgctg catctgcggt      2340
     ggggtgcctt caccaccggc ggcaccaccg gcggcaccgc cggcgcgcgg gcggcgttca      2400
     ccgccgtgcc cggcgaacgg ctctcggtca gggccgagat ggggctgcgc ggcttcggtc      2460
     tgcgctccca tccgtacgac gacgtgaccg aacccgacgc ggacgcccgg ctcggcgcgg      2520
     gcggtctgat ctcggtcgat ctcgagtccg ggatcatctt cgacttcttc ctcacacaca      2580
     gccggctcta cgcggtctac gagcggctcg cgctgcggcc ggacgccgag ttcgcggcct      2640
     tcacctcatg cgtcccggtc gcggaccgca cccccggcac gctccaccgg ctcgaggtcg      2700
     gatacgacgt cgcggccggc accgcccact ggacggccga cgggcaggag gtcctgtccg      2760
     tggaccggat cggcttccgc gcactggacg cgcgctggct ccggcgggac aacggcggcc      2820
     gcgaggaggc cgtacggccg cgcggactca gcttcggcct cgggctcttc ctggagcgcc      2880
     acttcggcca gggggtgcgg ctgtcggtgc gaaggctgtc ggtgctcacc tcgcccgccg      2940
     gctcccgcga ctcgtgacga cgaccaacga aaggcactgc gatgcccgat gagaacaagc      3000
     ccgtactggt cctcggcgcc accggaaagc aaggcggctc cgcggcccgg tacctgctgg      3060
     aacgcggctg gacagtccgg gccttcgtcc gggaccccgg cgcgcccaag gccaaggagc      3120
     tgcgtgagct gggggcgagc ctgcacaccg gcgacctgga ggacgccggc tcggtgcgcg      3180
     ccgcgatgaa gggtgcgtac ggcgtgttca gcatccaaac gccgatgaca ccggccggcg      3240
     tggagggcga ggagcggcag ggcaagatat gcgccgacgc cgcccgcgac ctcggcgtcc      3300
     agcactacgt ccacagctcg gtgggcggcg cggaacggcc ggagggcgtg aactggcggc      3360
     tgtccaagct cgcgatcgag cagcggatcc aggagaacgc gctccggttc accttcctgc      3420
     ggccgtcgta cttcatggag aacctgaacc acgacatgtc gcccctcgtc atggaggacg      3480
     gcgtgctgac cttccggagg gggctcgggc cggccaacac cctgcagatg atcagcggcc      3540
     ccgacatcgg gtacttcgcg gccgacgcct tcgacgaccc cgacaccttc ggcggcgcca      3600
     agatcgagct ggccggggac gagctgaccg gcgagcagat cgcggccgcg ttcggccggc      3660
     acaccgggct gcccgcccgc ttcgtgtcgg tgccgatacc ggagctgcac cgcacggggt      3720
     tcgagtggca ggcgatctcg tacacctggc tcaacggcat cggctatcac gccgacatcc      3780
     ccacgctgcg cgcccggttc ccgcagctgc tcaccctcga ccagtggctg gccaggaccg      3840
     gctggacccc gagggacccg gcatgagcga ggacacgatg acccaggagc ggccgtccct      3900
     gacggcacac gcccgccgga tcgccgaact cgccgggaag cgggcggccg acgccgaaca      3960
     gcagcgccgg ctgagccccg acgtcgtcga cgcggtcctt cgagccggtt tcgccgccca      4020
     cttcgtaccg gtggcgcacg gcggccgggc cgcgacgttc ggggagctgg tggagcccgt      4080
     cgcggtgctc ggcgaggcct gtgcctcgac cgcctggtac gcctcgctca cggcgagcct      4140
     cggccggatg gccgcctacc tgccggacga gggccaggcc gagctgtggt ccgacggccc      4200
     cgacgccctg atcgtcggtg ccctgatgcc gctgggccgg gccgagaaga ccccgggcgg      4260
     ctggcacgtg tcgggcacct ggccgttcgt cagcgtcgtg gatcactccg actgggcgct      4320
     gatctgcgcc aaggtcggcg aggagccgtg gttcttcgcg gtgccgcgac aggagtacgg      4380
     gatcgtcgac agctggtacc cgatgggtat gcgcggaacg ggcagcaaca cgctcgtcct      4440
     cgacggggtg ttcgtgccgg atgcgcgggc ctgcacccgt gcggccatcg cggcaggtct      4500
     cggtccggat gccgaggcga tctgtcacac cgtgcccatg agggcggtca acgggctggc      4560
     cttcgcactg ccgatgctcg gcgcggcccg cggggccgcg gccgtgtgga cctcgtggac      4620
     cgccggaaga ctggccgggc cgaccgggca gaacgccgtc tcgtcccagg accgcgtggt      4680
     gtacgagcac acgctggccc gggccacggg tgagatcgac gcggcccagc tgctgttgga      4740
     gcgggtcgcg gcggtcgccg acgccggctc ggcgaccggc gtactggtcg gccgcggggc      4800
     gcgggactgc gccctggcgg cggagctgct gaccgccgcg accgaccggc tgttcgcctc      4860
     ggcgggcacc cgggcacagg cccaggacag cccgatgcag cgcctgtggc gcgatgtgca      4920
     cgcggcgggc agccatatcg ggctgcagtt cgggcccggg gcggcgctgt acgccggaga      4980
     gctgttgagg aggagcaacg atggctgaag tgaacgatcc ccgggtgggc ttcgtcgcgg      5040
     tcgtcacctt cccggtggac ggccccgcca cccagcacaa gctggtggag ctggccaccg      5100
     gcggggtgca ggagtggatc cgcgaggtgc ccggcttcct gtcggccacg tatcacgcga      5160
     gcacggacgg gaccgcggtc gtcaactacg cccagtggga gagcgagcag gcctaccggg      5220
     tgaacttcgg cgccgacccg cgctcggcgg agctgcggga ggcgctgagc tcgctgcccg      5280
     ggctcatggg gccgccgaag gccgtgttca tgactccgcg gggggcgatc ctgccgtcct      5340
     gacctggtcg tccgcggcct cgccggcccc ggccagcagg ccggcgatga tgatctcgag      5400
//

If you have problems or comments...

PBIL Back to PBIL home page