(data stored in ACNUC9306 zone)

EMBL: X60671

ID   X60671; SV 1; linear; mRNA; STD; MUS; 2701 BP.
XX
AC   X60671;
XX
DT   26-NOV-1991 (Rel. 30, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 10)
XX
DE   M.musculus mRNA for ezrin
XX
KW   ezrin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2701
RA   Funayama N.;
RT   ;
RL   Submitted (12-JUL-1991) to the INSDC.
RL   N. Funayama, National Inst. for Physiological Sciences, Myodaizi Okazaki
RL   444, JAPAN
XX
RN   [2]
RP   1-2701
RX   DOI; 10.1083/jcb.115.4.1039.
RX   PUBMED; 1955455.
RA   Funayama N., Nagafuchi A., Sato N., Tsukita SA., Tsukita SH.;
RT   "Radixin is a novel member of the band 4.1 family";
RL   J. Cell Biol. 115(4):1039-1048(1991).
XX
RN   [3]
RP   1-2701
RX   PUBMED; 1429901.
RA   Sato N., Funayama N., Nagafuchi A., Yonemura S., Tsukita S., Tsukita S.;
RT   "A gene family consisting of ezrin, radixin and moesin. Its specific
RT   localization at actin filament/plasma membrane association sites";
RL   J. Cell Sci. 103:131-143(1992).
XX
DR   MD5; 1b0a979c35f3132dad0a8798acfac666.
DR   Ensembl-Gn; ENSMUSG00000052397; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023117; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023085; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023052; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023088; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022849; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023532; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022364; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022815; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022952; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022926; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023020; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022944; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023555; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022111; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022418; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000064234; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045456; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045435; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045399; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045407; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045153; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045889; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045269; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045056; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045207; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045172; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045285; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045148; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0045954; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044852; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044534; mus_musculus_wsbeij.
DR   EuropePMC; PMC1559712; 16674811.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2701
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt11"
FT                   /cell_line="F9"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        96..1856
FT                   /product="ezrin"
FT                   /db_xref="GOA:P26040"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:98931"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26040"
FT                   /protein_id="CAA43086.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYF
FT                   GLPYVDNKGFPTWLKLDKKVSAQEVRKENPVQFKFRAKFYPEDVAEELIQDITQKLFFL
FT                   QVKDGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKL
FT                   SRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
FT                   LGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   QLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLEAEKKRRETVEREKEQM
FT                   LREKEELMLRLQDYEQKTKRAEKELSEQIEKALQLEEERRRAQEEAERLEADRMAALRA
FT                   KEELERQAQDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVK
FT                   TKEELHLVMTAPPPPPPPVYEPVNYHVQEGLQDEGAEPMGYSAELSSEGILDDRNEEKR
FT                   ITEAEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNT
FT                   KQRIDEFEAM"
XX
SQ   Sequence 2701 BP; 739 A; 678 C; 759 G; 525 T; 0 other;
     ggtcccgacg cgtctccgcc gccctcgccc tcgccctcgc ctccgccgta cagccgaata        60
     gccgaggacc cacgcagagc caccaaccag ccaagatgcc caagccaatc aacgtccggg       120
     tgaccaccat ggatgccgag ctggagtttg ccatccagcc aaacaccacc gggaagcagc       180
     tctttgatca ggtggtaaag acgattggcc tccgggaagt gtggtacttc ggcctgccgt       240
     atgtagacaa taaaggattt cctacctggc tgaaacttga taaaaaggtc tccgcacagg       300
     aggtccgaaa ggagaaccct gtccagttta aattccgggc caagttctac cccgaagacg       360
     tggccgagga actcatccag gacatcacac agaagctctt cttcctgcaa gtcaaggacg       420
     ggatcctcag cgacgagatc tactgccccc cagagacagc cgtgctcctg ggctcctatg       480
     ccgttcaggc caagttcgga gattataaca aggaaatgca caagtctggg tacctcagct       540
     cggagcggct gatcccccag agagtcatgg accaacacaa gctcagcagg gaccagtggg       600
     aggaccggat ccaggtgtgg cacgcggaac accgagggat gctcaaggac agtgctatgc       660
     tggaatacct gaagattgcc caggacctgg aaatgtatgg gatcaactat ttcgagatca       720
     aaaacaagaa aggaacagac ctttggcttg gagtcgatgc ccttggactt aacatttatg       780
     agaaagatga caagttgacc ccaaagatcg gcttcccttg gagtgagatc aggaacatct       840
     ctttcaacga caagaagttt gtcattaagc ccatcgacaa gaaggcacct gactttgtgt       900
     tctacgcccc gcgcctgaga attaacaagc ggatcctgca gctctgcatg gggaaccatg       960
     agctgtacat gcgccgcagg aagcccgaca ccatcgaggt gcagcagatg aaggcccagg      1020
     ctcgggagga gaagcaccag aagcagctag agcgacagca gttggaagcc gagaagaaga      1080
     ggcgagagac ggtggagaga gaaaaggagc agatgctccg ggagaaggag gagctgatgc      1140
     ttcggctgca ggactacgag cagaagacca agagggcgga gaaagagctc tccgagcaga      1200
     ttgagaaggc cctccaactg gaggaagaga ggaggcgagc ccaggaggag gctgaacgtc      1260
     tggaggccga ccgcatggcc gccctgcggg ccaaggaaga actcgagaga caggcgcagg      1320
     atcagataaa gagccaggag cagctggctg cagagctggc agagtacacg gccaagatcg      1380
     cactgctgga ggaggcgcgg aggcgcaagg aggacgaggt agaagagtgg cagcaccggg      1440
     ctaaagaagc ccaggacgac ctggtgaaga ccaaagagga gctgcacctg gtgatgacgg      1500
     ccccaccgcc cccaccgccc ccagtgtatg agcctgtgaa ttaccacgtg caggagggac      1560
     tgcaggacga gggagcagag cctatgggct acagtgccga gctctccagt gagggcatcc      1620
     tggatgaccg caacgaggag aagcggatca cagaggcaga gaagaatgag cgcgtgcagc      1680
     ggcagctgct gaccctgagc aatgagttgt cccaggcccg ggatgagaac aagaggaccc      1740
     acaatgacat catccacaac gagaacatgc ggcaaggcag ggacaagtat aagacgctgc      1800
     ggcaaatcag gcagggcaac accaagcaac gcattgacga gttcgaggcc atgtagaggc      1860
     caggctggga ccaagggcag agggcacctc actgcaggca ggtgtcacac ttggctcttt      1920
     agttctctta agtttagaca cccccttgct gtgttccagt cccttaaaga gcagttacgg      1980
     ggcctgcatt ctgccccgag acccagtggg ctcctccttg gttccttcta attgtatcac      2040
     atagtgccaa acaggtcaga tttaatgaca gttaccgaat cacttcctgt ttggagcagg      2100
     gattcggagg gctggccctc atgaagcaag attcattgtc actgggacag cactgtggct      2160
     cacgggtgcc atacttttct ctagttttac aatgagctca aatcgatttt gttcttgatt      2220
     tttatgaagg atccatctct gtgtattgag gggtaaaaat gattttgaaa tttgagtcta      2280
     aagcatgccc ccacagagtc tccttcctcc agaccgctgg cagagtctcc aggggtcctt      2340
     cagagtgtac gggtacagga ctctccgata caaaattctc atgcttatct gttagcatac      2400
     attgttggac ttatatatct aatgatctgc tatagaggat agtatttata tataagccga      2460
     taatatgggt ttgtaacatt agttttaaaa aagggaaagt tttgttctgt atattttgtt      2520
     accttttaca gaataaaaga attcaacacc aagaaccatg taaccgagac acttgatctg      2580
     acacaggggc agtcgggaaa ccgatgactg cagtaatcac cactgtacaa aaatgttagt      2640
     gggttttgtg cacgtaaaat gcacacttcc gatttcctgt cagtttctta tttgaaaacc      2700
     c                                                                      2701
//

If you have problems or comments...

PBIL Back to PBIL home page