(data stored in SCRATCH zone)

GenBank: X62035

LOCUS       X62035                  1456 bp    DNA     linear   BCT 26-JUL-2016
DEFINITION  B.subtilis secA gene (partial).
ACCESSION   X62035 S55201
VERSION     X62035.1
KEYWORDS    protein transport; secA gene.
SOURCE      Bacillus subtilis
  ORGANISM  Bacillus subtilis
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
REFERENCE   1  (bases 1 to 1456)
  AUTHORS   Overhoff,B., Klein,M., Spies,M. and Freudl,R.
  TITLE     Identification of a gene fragment which codes for the 364
            amino-terminal amino acid residues of a SecA homologue from
            Bacillus subtilis: further evidence for the conservation of the
            protein export apparatus in gram-positive and gram-negative
            bacteria
  JOURNAL   Mol. Gen. Genet. 228 (3), 417-423 (1991)
   PUBMED   1832735
REFERENCE   2  (bases 1 to 1456)
  AUTHORS   Freudl,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-APR-1992) R. Freudl, Institut f. Biotechnologie,
            Forschungszentrum Juelich, Postfach 1913, 5170 Juelich, FRG
COMMENT     On Sep 24, 2004 this sequence version replaced S55201.1.
            See also D90218 & D10279.
FEATURES             Location/Qualifiers
     source          1..1456
                     /organism="Bacillus subtilis"
                     /mol_type="genomic DNA"
                     /strain="ATCC 6057"
                     /db_xref="taxon:1423"
                     /clone="pBO1"
                     /clone_lib="lambda gt11"
     regulatory      257..262
                     /regulatory_class="minus_35_signal"
     regulatory      279..284
                     /regulatory_class="minus_10_signal"
     regulatory      352..355
                     /regulatory_class="ribosome_binding_site"
     gene            364..>1456
                     /gene="secA"
     CDS_pept        364..>1456
                     /gene="secA"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="CAA43977.1"
                     /db_xref="GOA:P28366"
                     /db_xref="InterPro:IPR000185"
                     /db_xref="InterPro:IPR004027"
                     /db_xref="InterPro:IPR011115"
                     /db_xref="InterPro:IPR011116"
                     /db_xref="InterPro:IPR011130"
                     /db_xref="InterPro:IPR014018"
                     /db_xref="InterPro:IPR020937"
                     /db_xref="PDB:1M6N"
                     /db_xref="PDB:1M74"
                     /db_xref="PDB:1TF2"
                     /db_xref="PDB:1TF5"
                     /db_xref="PDB:2IBM"
                     /db_xref="PDB:3DL8"
                     /db_xref="PDB:3IQM"
                     /db_xref="PDB:3IQY"
                     /db_xref="PDB:3JV2"
                     /db_xref="UniProtKB/Swiss-Prot:P28366"
                     /translation="MLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHK
                     TIEFKERLEKGATTDDLLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKT
                     GEGKTLTSTLPVYLNALTGKGVHIVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMS
                     KDEKREAYAADITYSTNNELGFDYLRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEAR
                     TPLIISGQAAKSTKLYVQANAFVRTLKAEKDYTYDIKTKAVQLTEEGMTKAEKAFGID
                     NLFDVKHVALNHHINQALKAHVAMQKDVDYVVEDGQVVIVDSFTGRLMKGRRYSEGLH
                     QAIEAKEGLEIQNESMTLATITFQNYFRMY"
ORIGIN
        1 agaagaggag gagagcttgg acattgtccg tcagaaacgc tttaatttaa agccgatgga
       61 tagtgaagaa gcgatcttgc aaatgaatat gcttggccat aatttctttg ttttcacaaa
      121 tgcggaaaca aaccttacaa atgtcgtgta ccgcagaaat gacgggaaat atggcttaat
      181 tgaaccgact gaataatgaa gagaagcctt ccgtgatgtt cgcggaaggt ttttgttttt
      241 cttatttgca aattctttgg aaataacaaa aggtatgata tgataatgag aggtatacat
      301 ggactagtaa attatttata catgccttta aaataggcat gtgatgatag aggagcgtta
      361 taaatgcttg gaattttaaa taaaatgttt gatccaacaa aacgtacgct gaatagatac
      421 gaaaaaattg ctaacgatat tgatgcgatt cgcggagact atgaaaatct ctctgacgac
      481 gcgttgaaac ataaaacaat tgaatttaaa gagcgccttg aaaaaggggc gacaacggat
      541 gatcttcttg ttgaagcttt cgctgttgtt cgagaagctt cacgccgcgt aacaggcatg
      601 tttccgttta aagtccagct catggggggc gtggcgcttc atgacggaaa tatcgcggaa
      661 atgaaaacag gggaagggaa aacattaacg tctactctgc ctgtttattt aaatgcgtta
      721 acaggtaaag gcgtacacat cgtgactgtc aacgaatact tggcaagccg tgacgctgag
      781 caaatgggga aaattttcga gtttctcggt ttgactgtcg gcttgaattt aaactcaatg
      841 tcaaaagacg aaaaacggga agcttatgcc gctgatatta cttactccac aaacaacgag
      901 cttggcttcg actatttgcg tgacaatatg gttctttata aagagcagat ggttcagcgc
      961 ccgcttcatt ttgcggtaat tgatgaagtt gactctattt taattgatga agcgagaaca
     1021 ccgcttatca tttctggaca agctgcaaaa tccactaagc tgtacgtaca ggcaaatgct
     1081 tttgtccgta cgttaaaagc ggagaaggat tacacgtacg atatcaaaac aaaagctgta
     1141 cagcttactg aagaaggaat gacgaaggcg gaaaaagcgt tcggcatcga taacctcttt
     1201 gatgtgaagc atgtcgcgct caaccaccat atcaaccagg ccttaaaagc tcacgttgcg
     1261 atgcaaaagg acgttgacta tgtagtggaa gacggacagg ttgttattgt tgattccttc
     1321 acgggacgtc tgatgaaagg ccgccgctac agtgaggggc ttcaccaagc gattgaagca
     1381 aaggaagggc ttgagattca aaacgaaagc atgaccttgg cgacgattac gttccaaaac
     1441 tacttccgaa tgtacg
//

If you have problems or comments...

PBIL Back to PBIL home page