(data stored in ACNUC15468 zone)

EMBL: X62897

ID   X62897; SV 1; linear; mRNA; STD; MUS; 550 BP.
XX
AC   X62897;
XX
DT   05-DEC-1991 (Rel. 30, Created)
DT   12-JUN-2006 (Rel. 88, Last updated, Version 18)
XX
DE   Mus musculus mRNA for skeletal muscle chloride channel, destroyed by
DE   insertion of ETn transposon
XX
KW   c1c-1 gene; chloride channel; skeletal muscle chloride channel;
KW   transposon ETn.
XX
OS   Mus musculus domesticus (western European house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [3]
RX   DOI; 10.1038/354304a0.
RX   PUBMED; 1659665.
RA   Steinmeyer K., Klocke R., Ortland C., Gronemeier M., Jockusch H.,
RA   Grunder S., Jentsch T.J.;
RT   "Inactivation of muscle chloride channel by transposon insertion in
RT   myotonic mice";
RL   Nature 354(6351):304-308(1991).
XX
RN   [4]
RP   1-550
RA   Jentsch T.;
RT   ;
RL   Submitted (27-SEP-1991) to the INSDC.
RL   T. Jentsch Zentrum fuer Molekulare Neurobiologie (ZMNH) Martinistr. 52
RL   D-2000 Hamburg 20 FRG
XX
DR   MD5; 6b530f528a838c41f8f4cc7cbf27d7ea.
DR   Ensembl-Gn; ENSMUSG00000029862; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030646; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030619; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030544; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030629; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030342; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031083; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029746; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030318; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030462; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030418; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030550; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030452; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031113; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029458; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029822; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031894; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0077197; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0077278; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0077180; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0077218; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076836; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077686; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0077418; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0076799; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0076950; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0076845; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0076995; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076847; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077929; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076842; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075966; mus_musculus_wsbeij.
DR   EuropePMC; PMC18928; 11114168.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..550
FT                   /organism="Mus musculus domesticus"
FT                   /chromosome="6"
FT                   /strain="A2G adr"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="skeletal muscle cDNA from homozygous A2G adr
FT                   mouse"
FT                   /clone="cDNA3"
FT                   /tissue_type="skeletal muscle"
FT                   /db_xref="taxon:10092"
FT   CDS_pept        <1..>354
FT                   /codon_start=1
FT                   /gene="c1c-1"
FT                   /product="skeletal muscle chloride channel"
FT                   /db_xref="GOA:Q64347"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002243"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:88417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64347"
FT                   /protein_id="CAA44686.1"
FT                   /translation="AFAVIGICCGFLGAVFVYLHRQVMLGVRKHKCLSQFLAKHRLLYP
FT                   GIVTFVIASLTFPPGMGQFMAGELMPREAISTLFDNNTWVKHIGDPQSLGQSAVWLHPQ
FT                   VNVIIIILLFFVMK"
FT   mobile_element  355..>550
FT                   /mobile_element_type="transposon:Etn"
FT   regulatory      516..521
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 550 BP; 123 A; 154 C; 123 G; 150 T; 0 other;
     gcttttgctg tcattgggat ttgctgcggg ttcttgggag ctgttttcgt ttatctgcat        60
     cgccaagtca tgctcggtgt ccgaaagcac aagtgtctca gccaatttct tgctaagcac       120
     cgcctgctat atcctggaat tgttaccttt gtcatcgcct cgctcacatt tccaccagga       180
     atgggtcaat tcatggctgg agagctgatg ccccgtgaag ctatcagtac cctctttgac       240
     aacaacacat gggtaaagca cataggtgac ccccaaagct tgggccagtc agctgtgtgg       300
     cttcaccccc aggtcaacgt gatcatcatc atccttctct tcttcgttat gaagcctgaa       360
     acctgcttgc tcggggtgga gcttcctgct cattcgttct gccacgccca ctgctggaac       420
     ctgaggagcc acacacgtgc acctttctac tggaccagag attattcggc gggaatcggg       480
     tcccctcccc cttccttcat aactggtgtc acaacaataa aatttgagcc ttgatcagaa       540
     aaaaaaaaaa                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page