(data stored in ACNUC7421 zone)

EMBL: X66034

ID   X66034; SV 1; linear; genomic DNA; STD; PRO; 1334 BP.
XX
AC   X66034; S40530;
XX
DT   24-JUN-1992 (Rel. 32, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   B.subtilis pcp gene for pyrrolidone carboxyl peptidase
XX
KW   pcp gene.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1334
RA   Awade A.;
RT   ;
RL   Submitted (11-MAY-1992) to the INSDC.
RL   A. Awade, ENSBANA - Laboratoire de Biotechnologie, Campus Universitaire de
RL   Montmuzard, 21100 Dijon, FRANCE
XX
RN   [2]
RP   1-1334
RX   DOI; 10.1016/0014-5793(92)80656-2.
RX   PUBMED; 1353026.
RA   Awade A., Cleuziat P., Gonzales T., Robert-Baudouy J.;
RT   "Characterization of the pcp gene encoding the pyrrolidone carboxyl
RT   peptidase of Bacillus subtilis";
RL   FEBS Lett. 305(1):67-73(1992).
XX
DR   MD5; 8a6f469a5cf51a92a590cd1b0401cdf3.
DR   GOA; P42252.
DR   GOA; P42253.
DR   InterPro; IPR000192; Aminotrans_V_dom.
DR   InterPro; IPR002033; TatC.
DR   InterPro; IPR015421; PyrdxlP-dep_Trfase_major.
DR   InterPro; IPR015422; PyrdxlP-dep_Trfase_dom1.
DR   InterPro; IPR015424; PyrdxlP-dep_Trfase.
DR   InterPro; IPR019820; Sec-indep_translocase_CS.
DR   InterPro; IPR020578; Aminotrans_V_PyrdxlP_BS.
DR   UniProtKB/Swiss-Prot; P42252; TATCD_BACSU.
DR   UniProtKB/Swiss-Prot; P42253; YCBU_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1334
FT                   /organism="Bacillus subtilis"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="genomic in pMK4"
FT                   /clone="pAWPY4143"
FT                   /cell_line="QB 25"
FT                   /db_xref="taxon:1423"
FT   regulatory      469..474
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      492..497
FT                   /regulatory_class="minus_10_signal"
FT   CDS_pept        520..1167
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /product="TRANSFERRED ENTRY: 3.4.19.3"
FT                   /product="L-pyroglutamyl peptide hydrolase"
FT                   /EC_number="3.4.11.8"
FT                   /db_xref="GOA:P28618"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28618"
FT                   /protein_id="CAA46833.1"
FT                   /translation="MRKKVLITGFDPFDKETVNPSWEAAKRLNGFETEEAIITAEQIPT
FT                   VFRSALDTLRQAIQKHQPDIVICVGQAGGRMQITPERVAINLADARIPDNEGHQPIDEE
FT                   ISPDGPAAYWTRLPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTSPHIR
FT                   GGFIHIPYIPQQTIDKTAPSLSLDTIVRALRIAAVTAAQYDEDVKSPGGTLH"
XX
SQ   Sequence 1334 BP; 394 A; 329 C; 301 G; 310 T; 0 other;
     agtactgttt catccgaaat atgcgtttca tattgttcaa gcggcacgac gccgtctatt        60
     gatggaatga cggatacggt ataatcggag tgtgcctgcc aaacatgagg caccgccgaa       120
     aatccatatc tgtatataca acgtgcttct ttccaaatgc agttaaggac gatgctacag       180
     aaaccagtgc atcagaaact gacggcacaa tcgccacttc atccggttca gccccgatca       240
     gctttgcaaa ctcgtttctc gcaaactctg ttttttcaat cgcttctttc cagttcgtcc       300
     ctttatacag caggctatca taataatcct ggatcgccct tgatacaggc tctgcaatgc       360
     gctctgagaa cagctggcaa gcatcgtatg cgtctgcaag gttgggaata actggcgata       420
     ctgctccggc aaatgctcca ttatgattca ctcctttaca ttattttgat gaaaaaccca       480
     taaataaaca atagaataaa agaaaaagga gatgggagaa tgagaaaaaa agtgctgatc       540
     acaggctttg acccttttga caaagaaacc gtcaatccat catgggaagc ggcgaaacgg       600
     cttaatggct tcgagacaga agaagccatt attacagcgg aacaaattcc aaccgtcttt       660
     agatccgctc tggacactct gcgccaagcc attcaaaaac atcagccaga tatcgtaatt       720
     tgtgtcggcc aagcaggagg acggatgcag attacaccgg aacgagtggc aatcaacctt       780
     gcagatgcgc gaatccccga taacgaagga catcagccga ttgatgaaga gatttctcca       840
     gatgggcccg ccgcttactg gacaaggctt cccgtgaaac gaatgactgc taagatgaag       900
     gaacacggca ttccagctgc ggtttcctac acagcgggga cctttgtatg caactatttg       960
     ttctacgggt taatggatca cattagccgg acatccccac acattcgcgg cggttttatt      1020
     catattcctt acattccgca gcaaacaatc gacaaaacag cgccgagcct cagcctggac      1080
     acgattgtcc gggcattgag aatcgccgct gttacggccg cacaatatga tgaggatgtg      1140
     aagtcaccgg gtggtacgct gcactaagcg gccgccgctg tttcttccct catcctcttt      1200
     ttgtagacaa acgccgatag ggtgacactc acttcaaaca ggacaagaag cgggatcatc      1260
     acgagaaaat cagaaataaa atcaggcggt gtaatcaata tggacacgac aatcagcaga      1320
     aaataggaaa gctt                                                        1334
//

If you have problems or comments...

PBIL Back to PBIL home page