(data stored in ACNUC9306 zone)

EMBL: X74671

ID   X74671; SV 1; linear; mRNA; STD; MUS; 2604 BP.
XX
AC   X74671;
XX
DT   20-DEC-1993 (Rel. 38, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   M.musculus SCH mRNA for schwannomin
XX
KW   SCH gene; schwannomin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RC   revised by [3]  MAT
RA   Claudio J.O.;
RT   ;
RL   Submitted (19-AUG-1993) to the INSDC.
RL   J.O. Claudio, Center for Research in Neuroscience, The Montreal General
RL   Hospital Res. Inst., 1650 Cedar, Montreal H3G 1A4, CANADA
XX
RN   [2]
RP   1-2597
RX   DOI; 10.1093/hmg/3.1.185.
RX   PUBMED; 8162023.
RA   Claudio J.O., Marineau C., Rouleau G.A.;
RT   "The mouse homologue of the neurofibromatosis type 2 gene is highly
RT   conserved";
RL   Hum. Mol. Genet. 3(1):185-190(1994).
XX
RN   [3]
RP   1-2604
RA   Claudio J.O.;
RT   ;
RL   Submitted (24-FEB-1994) to the INSDC.
RL   J.O. Claudio, Center for Research in Neuroscience, The Montreal General
RL   Hospital Res. Inst., 1650 Cedar, Montreal H3G 1A4, CANADA
XX
RN   [4]
RP   1-2604
RX   DOI; 10.1006/geno.1994.1291.
RX   PUBMED; 8088840.
RA   Claudio J.O., Marineau C., Rouleau G.A.;
RT   "The mouse homologue of neurofibromatosis type 2 gene is highly conserved";
RL   Genomics 21(2):437-439(1994).
XX
DR   MD5; 7c0307b9a9d5ccf49adc38ccaec51a91.
DR   Ensembl-Gn; ENSMUSG00000009073; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017989; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017962; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017926; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017930; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017743; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018382; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017306; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017718; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017828; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017820; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017899; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017846; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018422; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017085; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017359; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000053079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109910; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027828; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027797; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027758; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027776; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027574; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028278; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027170; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027503; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027632; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027614; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027746; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027598; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028302; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026858; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027085; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2604
FT                   /organism="Mus musculus"
FT                   /strain="NIH Swiss Mice"
FT                   /mol_type="mRNA"
FT                   /clone_lib="mouse brain cDNA library AB711.1"
FT                   /note="ATCC No.37431"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..576
FT   CDS_pept        577..2367
FT                   /partial
FT                   /gene="SCH"
FT                   /product="schwannomin"
FT                   /db_xref="GOA:P46662"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="MGI:MGI:97307"
FT                   /db_xref="PDB:1ISN"
FT                   /db_xref="PDB:3WA0"
FT                   /db_xref="PDB:4P7I"
FT                   /db_xref="PDB:4ZRK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46662"
FT                   /protein_id="CAA52737.1"
FT                   /translation="MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKD
FT                   LFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPEN
FT                   AEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFL
FT                   AQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
FT                   TIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKID
FT                   VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLA
FT                   REKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLA
FT                   QKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDL
FT                   QEAREAERRAKQKLLEIATKPTYPPMNPIPPPLPPDIPSFDIIADSLSFDFKDTDMKRL
FT                   SMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDVLHSESSDRGGPSSKHN
FT                   TIKKLTLQSAKSRVAFFEEL"
FT   3'UTR           2565..2597
XX
SQ   Sequence 2604 BP; 662 A; 667 C; 765 G; 510 T; 0 other;
     ccgccaatca cagtatctta gagaaaaaag tgttagggtg agtcggtgag tagcgtagtg        60
     ggagtccgga ggcggggcgg ggcggggcgg ggatccggca gtcgctgagg tgggggttgg       120
     tagaggacgc ttcccgaggg cgcgcggacg agctggtgac agacacgcac acacgtgtgc       180
     gctcccaact actgcgcggc cccggccccg gccccggcac cctcgcgggg gtcgctgaga       240
     ggcccggcgt cggcgccgca gccgtctagg atttctgtcc aaaggcgtcc ctggcgtccc       300
     cagcccgaag ctccaagctc ggggctgcgc gtgcttttgc cggcatctcc ccccgaccct       360
     cccgtcgtca gagactgtcc cttaactcat ctttccgcac ccacagccgg gtcctcgcgg       420
     cccatgctgg ccgctgggga cccaggcagc ctaggtctgt ctcgggccgg ccagcacgcc       480
     atggtggccc tgaggcctgt gcagctactc caggggggct aagagaccca gaacgcgggc       540
     taggggtgag gggatccaag gccggtaccc cgcgccatgg ccggagccat cgcttctcgc       600
     atgagcttca gctcactcaa gaggaagcag cccaagacat tcacggtgcg gatcgtcacc       660
     atggacgccg agatggagtt caactgcgag atgaaatgga aggggaagga cctgtttgat       720
     ttggtgtgcc ggacactggg gcttcgggaa acctggttct ttggactgca gtatacaatc       780
     aaggacacgg tggcctggct caaaatggac aagaaggtgt tggatcatga tgtttcgaag       840
     gaagaaccag ttacctttca cttcctggcc aaattttatc ctgaaaatgc tgaggaggag       900
     ctagttcaag agatcacgca acacttattt ttcttacagg tgaagaagca gattttggat       960
     gaaaaggtct actgccctcc cgaggcgtcc gtgctcttgg cgtcatatgc tgtccaggcc      1020
     aagtatggcg actatgaccc ctctgtgcac aagcggggat ttttagccca agaggaattg      1080
     ctcccgaaaa gggtgataaa tctctatcag atgactccgg aaatgtggga ggagagaatt      1140
     acggcttggt atgcggaaca ccggggcaga gccagggatg aagctgaaat ggagtatttg      1200
     aagatagctc aggacctgga gatgtatggt gtgaactact ttacaatccg gaataaaaag      1260
     ggcacagagt tgctgcttgg agtggatgct cttgggcttc atatctatga ccctgagaac      1320
     aggctgaccc ccaagatctc cttcccatgg aatgaaatcc gaaacatctc ctacagcgac      1380
     aaggagttta ctattaaacc actggataag aaaattgatg tcttcaaatt taactcctca      1440
     aagcttcgtg ttaataagct gattcttcag ctatgtattg ggaaccatga cctatttatg      1500
     aggcgacgga aagctgactc tttagaagtt cagcagatga aagcccaggc cagggaagag      1560
     aaggctagaa agcagatgga aaggcagcgg ctggctcgag agaagcagat gcgggaggag      1620
     gccgagcgta caagagatga gttagagagg aggctcctgc agatgaaaga agaagcaacg      1680
     atggccaatg aagctctgat gcgctctgag gagacagctg atctgttggc tgaaaaggct      1740
     cagatcacag aggaggaggc caagcttttg gcacaaaagg ctgcagaggc tgagcaagag      1800
     atgcagcgaa tcaaggccac ggccattcgg acagaggagg agaagcgcct gatggagcag      1860
     aaggtgctgg aggctgaagt gctggcattg aagatggctg aggagtcaga gaggagggcc      1920
     aaggaggctg atcagttaaa gcaagacttg caagaagccc gagaagcaga gcgaagagcc      1980
     aagcagaagc tcttagaaat cgccaccaag cccacctatc cacccatgaa cccaattcca      2040
     ccaccactgc ctcctgacat accgagcttc gacattattg ctgacagctt gtcattcgac      2100
     ttcaaggata cggacatgaa gcgactttcc atggagatag agaaagaaaa agtggagtac      2160
     atggagaaga gcaagcacct gcaggagcag ctcaacgagc tcaagactga gatcgaggcc      2220
     ttgaaactca aagagcggga gacggccttg gacgtcctac acagcgagag ctcagacaga      2280
     ggcggcccca gcagcaagca taataccatt aaaaagctca ctctgcagag cgccaagtcc      2340
     cgagtggcct tctttgaaga actctagcag gtgacccggc cacctcctgc caacatctgc      2400
     tgctcctgac accaacagga tgggcctgac ccaaaaggaa ccatcagtag agggctggct      2460
     tgtttgggaa ctcttgagtt gagggccccg tgccactctg tccctataag agaggtttct      2520
     cacaatgtgt tctaggttct cccttgcctc ctgaataccc tgcatatctc tctctccctc      2580
     cctctctctc tctctccctt ctct                                             2604
//

If you have problems or comments...

PBIL Back to PBIL home page