(data stored in SCRATCH zone)

EMBL: X74737

ID   X74737; SV 1; linear; genomic DNA; STD; PRO; 2589 BP.
XX
AC   X74737;
XX
DT   02-FEB-1996 (Rel. 46, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   B.subtilis cwlD, rec223 and gerD genes
XX
KW   cwlD gene; gerD gene; rec223 gene.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2588
RA   Alonso J.;
RT   ;
RL   Submitted (18-AUG-1993) to the INSDC.
RL   J. Alonso, Max Planck Inst fuer Molekulare Genetik, Ihnestrasse 73, 14195
RL   Berlin, FRG
XX
RN   [2]
RP   1-2588
RA   Sekiguchi J., Akeo K., Yamamoto H., Khasanov F.K., Alonso J.C., Kuroda A.;
RT   "Nucleotide sequence and regulation of a new putative cell wall hydrolase
RT   gene, cwlD, which affects germination in Bacillus subtilis.";
RL   Unpublished.
XX
RN   [3]
RP   1-2589
RX   PUBMED; 7559346.
RA   Sekiguchi J., Akeo K., Yamamoto H., Khasanov F.K., Alonso J.C., Kuroda A.;
RT   "Nucleotide sequence and regulation of a new putative cell wall hydrolase
RT   gene, cwlD, which affects germination in Bacillus subtilis. ";
RL   J. Bacteriol. 177(19):5582-5589(1995).
XX
DR   MD5; 874a8830126edaf1f4e0756521470ec7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2589
FT                   /organism="Bacillus subtilis"
FT                   /map="20 degrees"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        64..507
FT                   /transl_table=11
FT                   /note="orf1"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50862"
FT                   /protein_id="CAA52755.1"
FT                   /translation="MAEVLSFMDVKRQKDFELEKNLLKELSLRQIIQSVKDCLEPLFPF
FT                   LHDERDIITEGCIDFAIEAYLLGGRFGIFGYYGESMQSISARSAREEEELRMEFFDYLY
FT                   NWIHEQYATFDKNTVYEAARKFIKDWWTAGFVQREKQCKLRMR"
FT   CDS_pept        567..1280
FT                   /transl_table=11
FT                   /gene="clwD"
FT                   /db_xref="GOA:P50864"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50864"
FT                   /protein_id="CAA52758.1"
FT                   /translation="MRKKLKWLSFLLGFIILLFLFKYQFSNNDSWKPWSLPLSGKIIYL
FT                   DPGHGGPDGGAVGGKLLEKDVTLEVAFRVRDYLQEQGALVIMTRESDTDLAPEGTKGYS
FT                   RRKAEDLRQRVKLINHSEAELYISIHLNAIPSQKWSGAQSFYYGKYAENEKVAKYIQDE
FT                   LRRNLENTTRKAKRIHGIYLMQNVTKPGALIEVGFLSNPSEATLLGKPKYQDKVASSIY
FT                   KGILRYFTEKGDPPE"
FT   CDS_pept        1376..2434
FT                   /transl_table=11
FT                   /gene="rec233"
FT                   /db_xref="GOA:P50863"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50863"
FT                   /protein_id="CAA52756.1"
FT                   /translation="MIREDEVRKLVGEMREPFLQRPLGELDAVKEIKIKPEKRHISVKV
FT                   ALAKTGTAEQMQIQQEIVNVLKGAGAETVGLRFEELPEETVAKFRAPSAEKKTLLNMDN
FT                   PPVFLAVASGKGGVGKSTVSVNLAISLARLGKKVGLIDADIYGFSVPDMMGITVRPTIE
FT                   GEKLLPVERFGVKVMSMGFFVEENAPVVWRGPMLGKMLNNFFHEVEWGEVDYIVLDLPP
FT                   GTGDVALDVHTMLPSCKEIIVSTPHPTAAFVAARAGSMAIKTDHEVVGVIENMAYYESA
FT                   KTGEREYVFGKGGGDKLAEELNVPLLGRIPLKQPDWDKDQFAPSVYDENHPIGEIYQDI
FT                   AKKIDAKMSVQV"
FT   CDS_pept        complement(2470..>2589)
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /db_xref="GOA:P16450"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16450"
FT                   /protein_id="CAA52757.1"
FT                   /translation="EFRSYLEEVINETLSSPLYKKQFEDELKKAAKDTAKESE"
XX
SQ   Sequence 2589 BP; 812 A; 470 C; 634 G; 673 T; 0 other;
     gaattcgggc attgtttcat catccaaacc tcaaaataat cggtaaaagg agagtgaatt        60
     tatatggcag aagtactgtc ttttatggat gtgaaacgcc aaaaggattt tgaattagaa       120
     aagaacttgc tcaaagaact ctctctgaga caaattatcc agtctgttaa ggattgtttg       180
     gaaccattat ttccattttt acatgatgaa cgagatatta ttaccgaagg ctgtattgat       240
     tttgcgattg aagcttattt gttaggcggg cgttttggga tattcggcta ttacggagaa       300
     tcaatgcaga gtatcagtgc ccgctctgca agagaagaag aagagctgcg tatggagttt       360
     tttgattatc tctataattg gatacacgag caatacgcaa catttgataa aaacactgtt       420
     tatgaagcgg cacgcaagtt cattaaagat tggtggacag cagggtttgt tcaaagagaa       480
     aaacagtgta agcttcgcat gcggtaatca tatttcccga ccctgtccca tagttatgta       540
     ataacggaca agcgggaggg gaagggatga ggaaaaagct taaatggctc agttttttgc       600
     taggcttcat catattacta tttctgttca agtatcagtt cagcaataac gactcttgga       660
     agccgtggag cctgcccttg agcggtaaaa tcatttatct agatccaggt catggcgggc       720
     ctgacggcgg agcagtcggc ggaaagctgt tagagaagga tgttaccctg gaagtggcct       780
     ttagagtcag ggattatctt caagaacaag gagcgcttgt tatcatgacc agagaaagtg       840
     atactgatct cgctccagaa ggaacaaaag gctatagccg acgaaaagct gaggatctaa       900
     gacaacgagt caaattaata aaccattcag aggcggagct ctatatcagc attcatctta       960
     atgcgattcc gtcacaaaaa tggagcggag cccaaagctt ttattacggg aaatatgcgg      1020
     aaaatgagaa agtcgcaaaa tacattcagg atgagctgag aagaaatctg gaaaacacaa      1080
     cccggaaagc aaagcggatt catggtatct acttaatgca aaacgtcacc aaaccggggg      1140
     cgcttataga agtcggattt ttatccaatc caagtgaagc aacgttgctc ggtaaaccga      1200
     aatatcaaga caaggtggca tcttccatat ataaaggcat tttgcgatat ttcacagaaa      1260
     aaggagaccc tccggagtaa tggagggttt tcttgtggtt ctaagcataa gacacccgcc      1320
     atttatgtat gatataataa taattgtaaa cgaatacaca aaagggtgag gttcgatgat      1380
     aagagaagat gaagtaagaa aactagtcgg agaaatgcgc gaaccttttc ttcaaagacc      1440
     tctgggagaa ttggatgccg ttaaggaaat taaaataaag cctgaaaaac ggcatatcag      1500
     tgtaaaagtc gctcttgcaa aaacaggaac tgcagaacaa atgcagattc agcaagagat      1560
     cgtaaacgta ttaaaagggg caggagctga gacagtcggc cttcgatttg aagagctgcc      1620
     tgaagaaacg gttgctaaat tccgggcgcc gtcagctgag aaaaaaacat tattaaatat      1680
     ggataacccg ccagtctttc ttgctgtagc aagtggaaaa ggcggcgtag gcaagtcaac      1740
     tgtgtcagta aacctagcta tttctctggc tcgtctaggg aaaaaggttg gtttaattga      1800
     tgcggatatt tatgggttca gtgtgccgga catgatgggt atcactgtgc gtccaacaat      1860
     tgaaggagag aaacttcttc ctgttgaacg ctttggagta aaggtcatgt caatgggctt      1920
     tttcgtagaa gaaaatgccc cggtcgtatg gagagggccg atgctcggca aaatgctgaa      1980
     taattttttc catgaagtag agtggggaga agtagactat atcgttcttg atcttccgcc      2040
     tggtacaggg gacgttgctc tcgatgtaca tacaatgctt ccgagctgca aagaaattat      2100
     cgtatctacg ccacatccga cagctgcttt tgtcgcggcc agagcgggct ctatggcgat      2160
     taaaaccgat catgaggtcg tgggtgtcat agagaacatg gcttattatg aaagtgcaaa      2220
     gacaggggaa agagaatatg tgtttggaaa aggcggagga gataaactgg ctgaggaact      2280
     aaacgtgcct ttgctcggca gaatcccatt gaaacagccc gattgggata aggaccaatt      2340
     tgctccgtct gtttatgacg aaaatcatcc aatcggagaa atatatcagg acatcgcaaa      2400
     aaaaatagat gcaaaaatgt cagtgcaggt ataaaaggtg aaccgggatt ccagatcccg      2460
     gctttccctt tattcacttt cttttgctgt gtcttttgct gcttttttca gctcatcttc      2520
     gaactgcttt ttgtaaagcg gactagaaag tgtttcgtta ataacctctt ctaaataact      2580
     gcggaattc                                                              2589
//

If you have problems or comments...

PBIL Back to PBIL home page