(data stored in ACNUC7421 zone)

EMBL: X79888

ID   X79888; SV 1; linear; mRNA; STD; HUM; 1548 BP.
XX
AC   X79888;
XX
DT   18-APR-1995 (Rel. 43, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   H.sapiens AUH mRNA
XX
KW   AU-binding protein; AUH gene; enoyl-CoA hydratase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1073/pnas.92.6.2051.
RX   PUBMED; 7892223.
RA   Nakagawa J., Waldner H.P., Meyer-Monard S., Hofsteenge J., Jeno P.,
RA   Moroni C.;
RT   "AUH, a gene encoding an AU-specific RNA binding protein with intrinsic
RT   enoyl-CoA hydratase activity";
RL   Proc. Natl. Acad. Sci. U.S.A. 92(6):2051-2055(1995).
XX
RN   [2]
RP   1-1548
RA   Nakagawa J.;
RT   ;
RL   Submitted (28-JUN-1994) to the INSDC.
RL   J. Nakagawa, Inst fuer Medizinische Mikrobiologie, Petersplatz 10, 4003
RL   Basel, SWITZERLAND
XX
DR   MD5; a46f5d49030071e651ba12ff2acdae7d.
DR   Ensembl-Gn; ENSG00000148090; homo_sapiens.
DR   Ensembl-Tr; ENST00000303617; homo_sapiens.
DR   Ensembl-Tr; ENST00000375731; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1548
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda Uni-Zap"
FT                   /cell_line="IMR32 human neuroblastoma"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        5..1024
FT                   /gene="AUH"
FT                   /product="AU-binding protein/Enoyl-CoA hydratase"
FT                   /db_xref="GOA:Q13825"
FT                   /db_xref="H-InvDB:HIT000323781.14"
FT                   /db_xref="HGNC:HGNC:890"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="PDB:1HZD"
FT                   /db_xref="PDB:2ZQQ"
FT                   /db_xref="PDB:2ZQR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13825"
FT                   /protein_id="CAA56260.1"
FT                   /translation="MAAAVAAAPGALGSLHAGGARLVAACSAWLCPGLRLPGSLAGRRA
FT                   GPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLS
FT                   KNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRA
FT                   VINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQ
FT                   RLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQ
FT                   GPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE"
XX
SQ   Sequence 1548 BP; 467 A; 298 C; 394 G; 389 T; 0 other;
     caacatggcg gccgcggtgg cggcggcacc tggggccttg ggatccctgc atgctggcgg        60
     cgcccgcctg gtggccgctt gcagtgcgtg gctctgcccg gggttgaggc tgcccggctc       120
     gttggcaggc cggcgagcgg gcccggcgat ctgggcccag ggctgggtac ctgcggccgg       180
     gggtcccgcc ccgaaaaggg gctacagctc tgagatgaag acggaggacg agctgcgggt       240
     gcggcacctg gaggaggaga accgaggaat tgtggtgctt ggaataaaca gagcttatgg       300
     caaaaattca ctcagtaaaa atcttataaa aatgctatca aaagctgtgg atgctttgaa       360
     atctgataag aaagtacgga ccataataat caggagtgaa gtcccaggga tattctgtgc       420
     tggtgctgac cttaaggaaa gagccaaaat gagttccagt gaagttggtc cttttgtctc       480
     caaaataaga gcagtgatta acgatattgc taatcttcca gtgccaacaa ttgcagcaat       540
     agatggactc gctttaggtg gtggtcttga actggcttta gcctgtgata tacgagtagc       600
     agcttcctct gcaaaaatgg gcctggttga aacaaaattg gcgattattc ctggtggagg       660
     ggggacacag cgattgccac gcgccattgg aatgtccctg gccaaggagc tcatattctc       720
     tgcgcgagtc ctcgatggca aagaagccaa agcagtgggc ttaatcagcc acgttctgga       780
     acagaaccag gagggagacg cggcctacag gaaggccttg gacctggcga gagagttttt       840
     acctcaggga cctgttgcaa tgagagtggc aaaattagca attaatcaag ggatggaggt       900
     cgatttagta acagggttag ccatagaaga agcttgttat gctcagacca ttccaacaaa       960
     agacagactt gaaggtcttc ttgcttttaa agagaaaagg ccccctcgct ataaaggaga      1020
     ataaaaggaa cagaaattct taagatgcca atgtaataaa tgtacttcct ggaagtgtct      1080
     ttcggatcca ctatatgcct cagcacatgg aaccttaatg accaaagtga agagcagatt      1140
     attcatacgg tgtaataagc gtctggaatg gacccatccg tgtacttcat tcaaatgtgt      1200
     aaatgtcata ttcattcaga tttataaagc tagtagtgta tagtcagaaa cagaatcaaa      1260
     gttagatata catttttaaa tatttactgc atatgaggct ttctgttaat tttttaatgt      1320
     gaataattta tatattgcac attctaggaa taatattgat tgtatgtcta ctgtgctgca      1380
     ttaagaaaat aaaatttcta tataccaaaa atgtgaagtt ataccaaata aagtttctaa      1440
     gtgattaatg catacgaaca gctacatata catatatcta aacctgaaaa atgaattgat      1500
     attctgagtg aaaactacct aatataaata aaattagtga aaagaaaa                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page