(data stored in ACNUC16935 zone)

EMBL: X81839

ID   X81839; SV 1; linear; mRNA; STD; ROD; 552 BP.
XX
AC   X81839;
XX
DT   31-OCT-1995 (Rel. 45, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   R.norvegicus mRNA for ubiquitin and ribosomal protein S27a
XX
KW   ribosomal protein S27a; ubiquitin; ubiquitin/ribosomal fusion protein.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-552
RA   Chan Y.L.;
RT   ;
RL   Submitted (22-SEP-1994) to the INSDC.
RL   Y.L. Chan, University of Chicago, 920 East 58th Street, Chicago, Illinois
RL   60637, USA
XX
RN   [3]
RP   1-552
RX   DOI; 10.1006/bbrc.1995.2518.
RX   PUBMED; 7488009.
RA   Chan Y.L., Suzuki K., Wool I.G.;
RT   "The carboxyl extensions of two rat ubiquitin fusion proteins are ribosomal
RT   proteins S27a and L40";
RL   Biochem. Biophys. Res. Commun. 215(2):682-690(1995).
XX
DR   MD5; a25bf922b18ff06db4079ea6237063d0.
DR   Ensembl-Gn; ENSRNOG00000004426; rattus_norvegicus.
DR   Ensembl-Gn; ENSRNOG00000034246; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000005872; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000049535; rattus_norvegicus.
DR   EuropePMC; PMC110283; 9765411.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..552
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /clone="pUb3-5 cDNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        43..513
FT                   /product="fusion protein: ubiquitin (bases 43_513);
FT                   ribosomal protein S27a (bases 217_532)"
FT                   /db_xref="GOA:P62982"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62982"
FT                   /protein_id="CAA57432.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLK
FT                   YYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK"
FT   regulatory      527..532
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 552 BP; 166 A; 110 C; 142 G; 133 T; 1 other;
     cttcctttcc gatccgccat cgttggtgga gcagccgcca cgatgcagat ttttgtgaag        60
     acccttacag ggaagaccat cacgctcgag gttgaaccct cggacactat agaaaatgta       120
     aaggccaaga tccaggataa ggaaggaatt cctcctgatc agcagaggtt gatctttgct       180
     ggtaagcagt tggaagatgg ccgtactttg tctgactaca acattcaaaa ggagtccact       240
     ctccatctcg tgctgagact tcgtggtggc gctaagaaaa ggaagaagaa gtcttacacc       300
     accccaaaga agaacaagca taagagaaag aaggtcaagt tggctgtgct gaaatactat       360
     aaggtggatg aaaatggcaa aatcagccga cttcgtcggg aatgtccttc tgatgaatgt       420
     ggtgctggag ttttcatggg tagccacttt gacaggcatt actgtggcaa gtgttgtctg       480
     acttactgct tcaacaaacc agaagacaag tagttgtgta tgagttaata aagagaagga       540
     actgatgtta an                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page