(data stored in ACNUC9552 zone)

EMBL: X82537

ID   X82537; SV 1; linear; genomic DNA; STD; ROD; 2232 BP.
XX
AC   X82537;
XX
DT   31-DEC-1994 (Rel. 42, Created)
DT   31-DEC-1994 (Rel. 42, Last updated, Version 2)
XX
DE   R.norvegicus bcl-x gene
XX
KW   bcl-x gene.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-2232
RA   Michaelidis T.M.;
RT   ;
RL   Submitted (04-NOV-1994) to the INSDC.
RL   T.M. Michaelidis, Max-Planck-Inst. for Psychiatry, Dept of Neurochemistry,
RL   82152 Martinsried, FRG
XX
RN   [2]
RP   1-2232
RA   Michaelidis T.M.;
RT   ;
RL   Unpublished.
XX
DR   MD5; 58bfefb6f0db470c9d8d85795af1998d.
DR   Ensembl-Gn; ENSRNOG00000007946; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000010762; rattus_norvegicus.
DR   EuropePMC; PMC2590760; 15545017.
DR   EuropePMC; PMC2855499; 15744743.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2232
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="embryonic"
FT                   /clone_lib="hippocampal cDNA libr. and genomic DNA libr."
FT                   /clone="X9, X31"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10116"
FT   5'UTR           <1..19
FT   CDS_pept        20..721
FT                   /gene="bcl-x"
FT                   /db_xref="GOA:P53563"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="PDB:1AF3"
FT                   /db_xref="PDB:4QNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53563"
FT                   /protein_id="CAA57886.1"
FT                   /translation="MSQSNQELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPER
FT                   ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRA
FT                   FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLV
FT                   SRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAG
FT                   VVLLGSLFSRK"
FT   CDS_pept        join(20..394,584..721)
FT                   /gene="bcl-x"
FT                   /note="smaller form due to splicing"
FT                   /db_xref="GOA:P53563"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="PDB:1AF3"
FT                   /db_xref="PDB:4QNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53563"
FT                   /protein_id="CAA57887.1"
FT                   /translation="MSQSNQELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPER
FT                   ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRA
FT                   FSDLTSQLHITPGTAYQSFEQDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
FT                   GSLFSRK"
FT   3'UTR           722..2232
FT   regulatory      2184..2189
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2232 BP; 479 A; 646 C; 602 G; 505 T; 0 other;
     gcccatctct attataaaaa tgtctcagag caaccaggag ctggtggttg actttctctc        60
     ctacaagctc tcccagaaag gatacagctg gagtcagttt agcgatgtcg aagagaacag       120
     gactgaagcc ccagaagaaa ctgaaccaga aagggagacc cccagtgcca tcaatggcaa       180
     cccatcctgg cacctggcgg atagccccgc ggtgaatgga gccactggcc acagcagcag       240
     tctggatgcg cgggaggtaa tccccatggc agcagtgaag caagcgctga gagaggctgg       300
     cgatgagttt gaactgcggt accggagagc attcagtgat ctaacatccc agcttcatat       360
     aaccccaggg acagcatatc agagctttga acaggtagtg aatgaactct ttcgggatgg       420
     ggtaaactgg ggtcgcattg tggccttctt ctcctttggc ggggcactgt gcgtggaaag       480
     cgtagacaag gagatgcagg tattggtgag tcggattgca agttggatgg ccacctacct       540
     gaatgaccac ctagagcctt ggatccagga gaacggcggc tgggacactt ttgtggatct       600
     ctacgggaac aatgcagcag ccgagagccg gaaaggccag gagcgtttca accgctggtt       660
     cctgacgggc atgactgtgg ctggtgtagt tctgctgggc tcactcttca gtcggaagtg       720
     accagacact gaccgtccac tcacctctca cctcccacct tgcccccacc acaactctct       780
     cttcagccac cattgctacc aggagaacca ctacatgcaa ctcacgcccc ttcccctatt       840
     atagggttgg gcctagacgg agtcccctgc agttaggttt ctagaatcta ccacgcttct       900
     gtgaaagcca ccttcccccc acatctcagt tcccttggcc tcaaaactca caaggttttt       960
     cctcagatca gctccttgga ggctggcagg agtgggaagg ggtgtgctag agggagaaga      1020
     gcctgccttg ttggtgggac cctgattacc cctgagcctc tcgggaatgc ttttctggca      1080
     gggagctgga gagctctcta aacctcttcc cccagagact agattgcctt ggttttgatg      1140
     tgtgtggcct cagaattgat catttcccat tctgctgtgt ccctggggcg gctcctcctt      1200
     cccatctcca cccccccccc ccccagagcc attgagtgag gtgcttttag cccttttgac      1260
     taactaaaaa tgcaggctgc ttgggataac gaggcaagga cctcctcccc acctgtggcc      1320
     tggccaagcc cccactcctg gtctgaatgt tctcctgagg cctctggcta gagtccagcc      1380
     ccacccagga ggagggacgg agctgcggaa agtccaccct gcgagagcct gagcggctct      1440
     tgcggcttag caccacccca gatccttctc cacccctccc ctggctccat ggtgaccatg      1500
     actgagggac caactgggcc cacgctaggt gccccagagc tgttaatgac ttcagctgcc      1560
     tcacttcctg caagatcagc ctgtggcatc tttgccttgg gtgctggcca cagggtccag      1620
     ggactctggc cttagcccag aagtgagagg aagcttacag cgcagctatg ggagccctgg      1680
     gggcttccct acctcaggca ggaagggcag gaagaagagc ctggtgcaca ggtgaggagg      1740
     actgcaaggg cctgtctgtg ccctgtcccc acctgtctgc agcagggctg ccaaggtcag      1800
     aatgccctgg ccaggagccc ttcaggcctc tcctctgctc cacccttggc ctgtctcatc      1860
     cctgtgggtc ccagctcagc tctggccacc ccgggctctc tgctgtacat atctgagact      1920
     agtttttatt ccttgtgaag atgatatact atttttgtta agcgtgtctg tatttatgta      1980
     tgaggagctg ctggcttgct gtgcgcgtgc ccgtggagag ctggtgccca gagactgaca      2040
     gcctgacgct ccctccctgc cctgcctggg gaacccactg agggtcgtgg cttctgagag      2100
     gcacctgtcc ctctcctccc ctcaccctac actttttcca gctctttgaa atagtttgtg      2160
     tgaaggtgaa agtgcagttc agtaataaat ggtgtctgtg actctgtgaa aaaaaaaaaa      2220
     aaaaaaaaaa aa                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page