(data stored in ACNUC16935 zone)

EMBL: X82636

ID   X82636; SV 1; linear; mRNA; STD; ROD; 467 BP.
XX
AC   X82636;
XX
DT   31-OCT-1995 (Rel. 45, Created)
DT   31-OCT-1995 (Rel. 45, Last updated, Version 4)
XX
DE   R.norvegicus mRNA for a fusion protein of ubiquitin and ribosomal protein
DE   L40
XX
KW   ribosomal protein L40; ubiquitin.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RX   DOI; 10.1006/bbrc.1995.2518.
RX   PUBMED; 7488009.
RA   Chan Y.L., Suzuki K., Wool I.G.;
RT   "The carboxyl extensions of two rat ubiquitin fusion proteins are ribosomal
RT   proteins S27a and L40";
RL   Biochem. Biophys. Res. Commun. 215(2):682-690(1995).
XX
RN   [2]
RP   1-467
RA   Chan Y.;
RT   ;
RL   Submitted (11-NOV-1994) to the INSDC.
RL   Y. Chan, Univ.of Chicago, 920 East 58th Street, Chicogo, Illinois 60637,
RL   USA
XX
DR   MD5; 30fb333c5f750daf9bc6f32b96b29475.
DR   Ensembl-Gn; ENSRNOG00000019974; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000027073; rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..467
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /clone="pUb1-7"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        12..398
FT                   /product="ubiquitin/ribosomal protein L40"
FT                   /db_xref="GOA:P62986"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62986"
FT                   /protein_id="CAA57958.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
FT   misc_feature    12..239
FT                   /note="coding for ubiquitin"
FT   misc_feature    240..398
FT                   /note="coding for ribosomal protein L40"
FT   regulatory      435..440
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 467 BP; 123 A; 149 C; 117 G; 77 T; 1 other;
     cggcagccaa catgcagatc ttcgtgaaga ccctgacggg caagaccatc actcttgagg        60
     tcgagcccag tgacaccatc gagaatgtca aggccaagat ccaagacaag gaaggcatcc       120
     cccctgacca gcagagactg atctttgctg gcaaacagct ggaggatggc cgcaccctgt       180
     ccgactacaa catccagaaa gagtccacct tgcacctggt gctgcgtctt cgcggtggca       240
     tcatcgagcc gtcccttcgt cagcttgccc agaagtacaa ctgtgacaag atgatctgcc       300
     gcaagtgcta cgcacgcctg cacccccgtg cagtcaactg ccgcaagaag aagtgcggcc       360
     acaccaacaa cctgcgcccc aagaagaagg tcaaatagag ctgggcctat acctggcctg       420
     tgaccccggg accaaataaa gtccccttcc atcgactgga gcagtan                     467
//

If you have problems or comments...

PBIL Back to PBIL home page