(data stored in SCRATCH zone)

EMBL: X84239

ID   X84239; SV 1; linear; mRNA; STD; MUS; 711 BP.
XX
AC   X84239;
XX
DT   16-JUN-1995 (Rel. 44, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   M.musculus mRNA for rab5b protein
XX
KW   RAB5B gene; rab5b protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-711
RA   Bucci C.;
RT   ;
RL   Submitted (31-JAN-1995) to the INSDC.
RL   C. Bucci, Dept.di Biologia e Patologia Cellulare e Molecolare, University
RL   of Napoli, II Policlinico, via Pansini 5, 80131 Napoli, ITALY
XX
RN   [2]
RP   1-711
RX   DOI; 10.1016/0014-5793(95)00477-Q.
RX   PUBMED; 7789520.
RA   Bucci C., Lutcke A., Steele Mortimer O., Olkkonen V.M., Dupree P.,
RA   Chiariello M., Bruni C.B., Simons K., Zerial M.;
RT   "Co-operative regulation of endocytosis by three Rab5 isoforms";
RL   FEBS Lett. 366(1):65-71(1995).
XX
DR   MD5; c183c2e6427dc1c068fc2782ef50b96b.
DR   Ensembl-Gn; ENSMUSG00000000711; mus_musculus.
DR   Ensembl-Gn; MGP_AKRJ_G0017815; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017816; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017639; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017200; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017609; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017715; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017710; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017738; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018311; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016985; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017259; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000727; mus_musculus.
DR   Ensembl-Tr; MGP_AKRJ_T0027471; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027484; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027292; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026888; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027221; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027344; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027329; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027320; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028015; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026594; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026811; mus_musculus_wsbeij.
XX
CC   Related sequences: M79311
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..711
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="mouse kidney cDNA"
FT                   /tissue_type="kidney"
FT                   /germline
FT                   /db_xref="taxon:10090"
FT   CDS_pept        51..698
FT                   /gene="RAB5B"
FT                   /product="rab5b"
FT                   /db_xref="GOA:P61021"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:105938"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61021"
FT                   /protein_id="CAA59016.1"
FT                   /translation="MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQF
FT                   HEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITN
FT                   QETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETS
FT                   AKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN"
XX
SQ   Sequence 711 BP; 201 A; 160 C; 201 G; 149 T; 0 other;
     gcttcgccat ggaacaaaaa ctcatctcag aagaggatct gggaggacat atgactagca        60
     gaagtacagc caggcccaat gggcaacccc aggccagcaa aatatgccag ttcaaattgg       120
     tcctgctggg agagtctgca gtggggaagt ctagcctggt gttacgtttt gtcaaaggac       180
     agttccatga ataccaggaa agcaccattg gagcggcctt cctcacccaa tccgtgtgtt       240
     tagatgacac aacagtcaag tttgagatct gggacactgc tgggcaggag cgataccaca       300
     gtttagcccc tatgtactac aggggtgccc aggctgcaat cgtggtctat gatattacta       360
     atcaggaaac gtttgctcgg gcaaagacat gggtaaagga actacagcgg caagccagcc       420
     ctagcattgt tattgccttg gcagggaaca aagctgacct tgccaacaag cgcatggtgg       480
     agtatgaaga ggctcaggca tatgcagatg acaacagctt attatttatg gagacttcag       540
     ctaagactgc tatgaacgtg aatgatctct tcctggcaat agcaaagaag ttgccaaaga       600
     gcgaacccca gaatctgggg ggtgcggcag gccgaagtcg gggtgtggat cttcatgagc       660
     agtcccagca gaacaagagc cagtgttgta gcaactgagg ggtggctagc a                711
//

If you have problems or comments...

PBIL Back to PBIL home page