(data stored in ACNUC27125 zone)

EMBL: X86098

ID   X86098; SV 1; linear; mRNA; STD; HUM; 2722 BP.
XX
AC   X86098;
XX
DT   11-JUL-1995 (Rel. 44, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   H.sapiens mRNA for BS69 protein
XX
KW   BS69 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   PUBMED; 7621829.
RA   Hateboer G., Gennissen A., Ramos Y.F.M., Kerkhoven R.M., Sonntag-Buck V.,
RA   Stunnenberg H.G., Bernards R.;
RT   "BS69, a novel adenovirus E1A-associated protein that inhibits E1A
RT   transactivation";
RL   EMBO J. 14(13):3159-3169(1995).
XX
RN   [2]
RP   1-2722
RA   Bernards R.;
RT   ;
RL   Submitted (06-APR-1995) to the INSDC.
RL   R. Bernards, Netherlands Cancer Institute, Divisions of Molecular
RL   Carcinogenesis, Plesmanlaan 121, 1066 CX Amsterdam, NETHERLANDS
XX
DR   MD5; 15e84923b0fc88b6d6830b31cd4ee812.
DR   Ensembl-Gn; ENSG00000015171; homo_sapiens.
DR   Ensembl-Tr; ENST00000381591; homo_sapiens.
DR   Ensembl-Tr; ENST00000381607; homo_sapiens.
DR   Ensembl-Tr; ENST00000397959; homo_sapiens.
DR   Ensembl-Tr; ENST00000397962; homo_sapiens.
DR   Ensembl-Tr; ENST00000509513; homo_sapiens.
DR   Ensembl-Tr; ENST00000558098; homo_sapiens.
DR   Ensembl-Tr; ENST00000602682; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2722
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="T84"
FT                   /tissue_type="colon carcinoma"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        245..1933
FT                   /gene="BS69"
FT                   /function="inhibits E1A mediated transactivation"
FT                   /note="binds directly to adenovirus type 5 E1A protein"
FT                   /db_xref="GOA:Q15326"
FT                   /db_xref="H-InvDB:HIT000324191.15"
FT                   /db_xref="HGNC:HGNC:16966"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR035505"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="PDB:4NS5"
FT                   /db_xref="PDB:5HDA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15326"
FT                   /protein_id="CAA60052.1"
FT                   /translation="MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGY
FT                   WLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPV
FT                   CRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQE
FT                   KVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCF
FT                   YLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIP
FT                   SENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSIS
FT                   STSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIEKVSVSTQ
FT                   TKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREAL
FT                   EKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQT
FT                   KKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR"
XX
SQ   Sequence 2722 BP; 879 A; 515 C; 617 G; 711 T; 0 other;
     ggagcataat gctaaagaag taaacaggtc atggcacgtt taacaaaaag acgacaggcg        60
     atacaaaagc tatccagcat ctttgggcag ccattgagat tatacggaac cagaagcaga       120
     ttgccaacat tgaccgtatt acaaaatgtg aaacaactac attattcttg aacctatggt       180
     gatttttaca tcattacaca gatatgtcat tttcattagt tgtatcattg ttataaactg       240
     gtatatgtct cgagtccacg gtatgcaccc taaagagacc acccgtcagc tgagcttagc       300
     tgtgaaagat ggtcttattg tcgaaactct aacagtgggc tgcaaaggtt caaaagctgg       360
     tattgaacaa gaaggatatt ggttgccagg agatgagatt gactgggaaa cagaaaatca       420
     tgactggtat tgttttgaat gccatttgcc tggagaggtg ttgatatgtg acctgtgttt       480
     tcgtgtgtat cattccaagt gtttgtctga tgagttcagg cttagagaca gcagtagtcc       540
     ctggcagtgc ccagtttgca ggagcattaa gaagaagaat acaaacaaac aggagatggg       600
     cacatacctc agattcattg tctcccgcat gaaggagagg gctatagatc ttaataaaaa       660
     ggggaaggac aataaacacc cgatgtacag gaggctggtg cactcagctg tggacgttcc       720
     caccattcaa gagaaagtga atgaagggaa ataccgaagt tatgaagagt tcaaagctga       780
     tgcccaattg cttctccaca ataccgtgat tttctatgga gcagacagtg agcaagctga       840
     cattgcgagg atgctatata aagacacatg tcatgagctg gatgaactgc agctttgcaa       900
     gaattgcttt tacttgtcaa atgctcgtcc tgacaactgg ttctgttatc cttgtatacc       960
     taatcatgag ctggtttggg ctaaaatgaa aggttttggg ttttggccag ccaaagtcat      1020
     gcagaaagaa gacaatcaag tcgacgttcg cttctttggc caccaccacc agagggcctg      1080
     gattccttct gaaaacattc aagatatcac agtcaacatt catcggctgc acgtgaagcg      1140
     cagtatgggt tggaaaaagg cctgtgatga gctggagctg catcagcgtt tcctacgaga      1200
     agggagattt tggaaatcta agaatgagga ccgaggtgag gaagaggcag aatccagtat      1260
     ctcctccacc agtaatgagc agctaaaggt cactcaagaa ccaagagcaa agaaaggacg      1320
     acgtaatcaa agtgtggagc ccaaaaagga agaaccagag cctgaaacag aagcagtaag      1380
     ttctagccag gaaataccca cgatgcctca gcccatcgaa aaagtctccg tgtcaactca      1440
     gacaaagaag ttaagtgcct cttcaccaag aatgctgcat cggagcaccc agaccacaaa      1500
     cgacggcgtg tgtcagagca tgtgccatga caaatacacc aagatcttca atgacttcaa      1560
     agaccggatg aagtcggacc acaagcggga gacagagcgt gttgtccgag aagctctgga      1620
     gaagctgcgt tctgaaatgg aagaagaaaa gagacaagct gtaaataaag ctgtagccaa      1680
     catgcagggt gagatggaca gaaaatgtaa gcaagtaaag gaaaagtgta aggaggaatt      1740
     tgtagaagaa atcaagaagc tggcaacaca gcacaagcaa ctgatttctc agaccaagaa      1800
     gaagcagtgg tgctacaact gtgaggagga ggccatgtac cactgctgct ggaacacatc      1860
     ctactgctcc atcaagtgcc agcaggagca ctggcacgcg gagcacaagc gcacctgccg      1920
     ccggaaaaga tgaagctggc ccttcccgga gtcaccccga tgattactct tttcagacac      1980
     agcggttttt gtttccaaga agccaaaatt gtttagaatt tgcttcccat tttgcaccag      2040
     cctttaaaca cttttcgtga agaaattttg cacagtagtt taaatctttt gttaatgctc      2100
     ctccgaagtt tttcaggggg taaaagtaac atcagtggag ggtattattt taaataaatt      2160
     ttaattgaga atttgttgca ttttcagcaa attttaaaac atttttaggt tttacagaga      2220
     ttttaacctt taaacaacag atctttaaaa aacaggtgaa tacaagtgag tttaacaaag      2280
     aaacatttag aatagatctg aatgtaagaa ctacagaact gtttcagaaa taaaacatac      2340
     taccttgatg tgacattttt ttcttaacct tgttgagctg gttttgttca gcttaattta      2400
     ctgttcaaag gcattatctg ttggtcacac cagtgggtat atgattgaat ttagggaaca      2460
     gggttgacac agcagggcta gtcctgcata ttttttctta aatatttccc aattgtgttt      2520
     ttcattattt cttttcaata tataactttt ataacaaatt attagctttg atcttgtagt      2580
     ttaaaattgc agggaactgg ggtaatcttt tactgagctg gatcttagag aaaatgaata      2640
     tttaaatttt aaagtttgcc acatttcatc tttgtcctaa catgagtgct tgtaacaaaa      2700
     taaaacaaca aaaacaaagc ct                                               2722
//

If you have problems or comments...

PBIL Back to PBIL home page