(data stored in ACNUC16935 zone)

EMBL: X92661

ID   X92661; SV 1; linear; mRNA; STD; ROD; 344 BP.
XX
AC   X92661;
XX
DT   02-NOV-1995 (Rel. 45, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   R.norvegicus mRNA for polyubiquitin 5' end
XX
KW   polyubiquitin; UBC gene.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RX   DOI; 10.1016/S0008-6363(96)00220-9.
RX   PUBMED; 9074707.
RA   Adam P.J., Weissberg P.L., Nathaniel R.B., Shanahan C.M.;
RT   "Polyubiquitin is a new phenotypic marker of contractile vascular smooth
RT   muscle cells";
RL   Cardiovasc. Res. 33(2):416-421(1997).
XX
RN   [2]
RP   1-344
RA   Adam P.J.;
RT   ;
RL   Submitted (28-OCT-1995) to the INSDC.
RL   P.J. Adam, Dept.of Medicine, University of Cambridge, Cardiovascular
RL   Research Group, Level 5, Addenbrookes Hospital, Cambs CB2 2QQ, UK
XX
DR   MD5; 4eff951c32dcb387493dc72971aeac59.
XX
CC   Related sequences: D16554 & D17296
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..344
FT                   /organism="Rattus norvegicus"
FT                   /strain="Wistar"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="cDNA lambda ZAP"
FT                   /clone="2E10"
FT                   /cell_line="day 7, vascular smooth muscle"
FT                   /cell_type="vascular smooth muscle"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        45..>344
FT                   /gene="UBC"
FT                   /product="polyubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q63654"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAA63349.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE"
XX
SQ   Sequence 344 BP; 93 A; 101 C; 88 G; 62 T; 0 other;
     ccgtctctac tcttttgtga ggactgcagc caacaccgct gacaatgcag atctttgtga        60
     aaaccttaac tggtaagacc atcaccctgg aggtcgagcc cagtgacacc attgaaaatg       120
     tcaaggcaaa gatccaggac aaggagggca tcccccctga ccagcagagg ctgatctttg       180
     caggcaagca gctggaagat ggccgcaccc tgtcagacta caacatccag aaggagtcca       240
     ccctgcacct ggtcctgcgc ctcagagggg gcatgcagat ctttgtgaag accctgacag       300
     gcaagaccat caccctggag gtcgagccca gtgacaccat tgaa                        344
//

If you have problems or comments...

PBIL Back to PBIL home page