(data stored in ACNUC8465 zone)

EMBL: X96757

ID   X96757; SV 1; linear; mRNA; STD; HUM; 1587 BP.
XX
AC   X96757;
XX
DT   17-AUG-1996 (Rel. 49, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   H.sapiens mRNA for MAP kinase kinase
XX
KW   MAP kinase kinase; SAPKK3 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1587
RX   PUBMED; 8861944.
RA   Cuenda A., Alonso G., Morrice N., Jones M., Meier R., Cohen P.,
RA   Nebreda A.R.;
RT   "Purification and cDNA cloning of SAPKK3, the major activator of RK/p38 in
RT   stress- and cytokine-stimulated monocytes and epithelial cells";
RL   EMBO J. 15(16):4156-4164(1996).
XX
RN   [2]
RP   1-1587
RA   Nebreda A.;
RT   ;
RL   Submitted (21-MAR-1996) to the INSDC.
RL   A. Nebreda, European Molecular Biology Laboratory, Meyerhofstrasse 1, D-
RL   69117 Heidelberg, FRG
XX
DR   MD5; 856b6e03fbba2f649e9f1f34b532741d.
DR   Ensembl-Gn; ENSG00000108984; homo_sapiens.
DR   Ensembl-Tr; ENST00000589647; homo_sapiens.
DR   Ensembl-Tr; ENST00000590474; homo_sapiens.
DR   Ensembl-Tr; ENST00000613873; homo_sapiens.
XX
CC   Related sequences: U39064, U39065, U39066, U39656 & U39657
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1587
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="BJAB"
FT                   /cell_type="B cell"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        273..1277
FT                   /gene="SAPKK3"
FT                   /product="MAP kinase kinase"
FT                   /db_xref="GOA:P52564"
FT                   /db_xref="H-InvDB:HIT000324962.14"
FT                   /db_xref="HGNC:HGNC:6846"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:2Y8O"
FT                   /db_xref="PDB:3ENM"
FT                   /db_xref="PDB:3FME"
FT                   /db_xref="PDB:3VN9"
FT                   /db_xref="PDB:5ETF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52564"
FT                   /protein_id="CAA65532.1"
FT                   /translation="MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQN
FT                   FEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISM
FT                   RTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIV
FT                   KALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAP
FT                   ERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD
FT                   KFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD"
XX
SQ   Sequence 1587 BP; 493 A; 334 C; 359 G; 401 T; 0 other;
     cttttagctg ccagccctgg cccatcatgt agctgcagca cagccttccc taacgttgca        60
     actgggggaa aaatcacttt ccagtctgtt ttgcaaggtg tgcatttcca tcttgattcc       120
     ctgaaagtcc atctgctgca tcggtcaaga gaaactccac ttgcatgaag attgcacgcc       180
     tgcagcttgc atctttgttg caaaactagc tacagaagag aagcaaggca aagtcttttg       240
     tgctcccctc ccccatcaaa ggaaagggga aaatgtctca gtcgaaaggc aagaagcgaa       300
     accctggcct taaaattcca aaagaagcat ttgaacaacc tcagaccagt tccacaccac       360
     ctagagattt agactccaag gcttgcattt ctattggaaa tcagaacttt gaggtgaagg       420
     cagatgacct ggagcctata atggaactgg gacgaggtgc gtacggggtg gtggagaaga       480
     tgcggcacgt gcccagcggg cagatcatgg cagtgaagcg gatccgagcc acagtaaata       540
     gccaggaaca gaaacggcta ctgatggatt tggatatttc catgaggacg gtggactgtc       600
     cattcactgt caccttttat ggcgcactgt ttcgggaggg tgatgtgtgg atctgcatgg       660
     agctcatgga tacatcacta gataaattct acaaacaagt tattgataaa ggccagacaa       720
     ttccagagga catcttaggg aaaatagcag tttctattgt aaaagcatta gaacatttac       780
     atagtaagct gtctgtcatt cacagagacg tcaagccttc taatgtactc atcaatgctc       840
     tcggtcaagt gaagatgtgc gattttggaa tcagtggcta cttggtggac tctgttgcta       900
     aaacaattga tgcaggttgc aaaccataca tggcccctga aagaataaac ccagagctca       960
     accagaaggg atacagtgtg aagtctgaca tttggagtct gggcatcacg atgattgagt      1020
     tggccatcct tcgatttccc tatgattcat ggggaactcc atttcagcag ctcaaacagg      1080
     tggtagagga gccatcgcca caactcccag cagacaagtt ctctgcagag tttgttgact      1140
     ttacctcaca gtgcttaaag aagaattcca aagaacggcc tacataccca gagctaatgc      1200
     aacatccatt tttcacccta catgaatcca aaggaacaga tgtggcatct tttgtaaaac      1260
     tgattcttgg agactaaaaa gcagtggact taatcggttg accctactgt ggattggtgg      1320
     gtttcggggt gaagcaagtt cactacagca tcaatagaaa gtcatctttg agataattta      1380
     accctgcctc tcagagggtt ttctctccca attttctttt tactccccct cttaaggggg      1440
     ccttggaatc tatagtatag aatgaactgt ctagatggat gaattatgat aaaggcttag      1500
     gacttcaaaa ggtgattaaa tatttaatga tgtgtcatat gaaaaaaaaa aaaaaaaaaa      1560
     aaaaaaaaaa aaaaaaaaaa aaaaaaa                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page