(data stored in ACNUC8465 zone)

EMBL: X97751

ID   X97751; SV 1; linear; genomic DNA; STD; FUN; 23096 BP.
XX
AC   X97751;
XX
DT   14-MAY-1996 (Rel. 47, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 12)
XX
DE   S.cerevisiae chrIV genes STE7, CLB3, MSH5, RPC53, RET1
XX
KW   CLB3 gene; cyclin B; DNA directed RNA polymerase III; MSH5 gene; ret1 gene;
KW   RPC53 gene; STE7 gene.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RX   DOI; 10.1002/(SICI)1097-0061(199612)12:15<1587::AID-YEA46>3.0.CO;2-6.
RX   PUBMED; 8972581.
RA   Delaveau T., Blugeon C., Jacq C., Perea J.;
RT   "Analysis of a 23 kb region on the left arm of yeast chromosome IV";
RL   Yeast 12(15):1587-1592(1996).
XX
RN   [2]
RC   revised by [3]  MAT
RA   Delaveau T.T.D.;
RT   ;
RL   Submitted (09-MAY-1996) to the INSDC.
RL   T.T.D. Delaveua, Laboratoire De Biologie Moleculaire, CNRS URA 1302, Ecole
RL   Normale Superieure, 46 Rue D'Ulm, 75230 Paris, CEDEX 01, FRANCE
XX
RN   [3]
RP   1-23096
RA   Delaveau T.T.D.;
RT   ;
RL   Submitted (20-MAY-1996) to the INSDC.
RL   T.T.D. Delaveua, Laboratoire De Biologie Moleculaire, CNRS URA 1302, Ecole
RL   Normale Superieure, 46 Rue D'Ulm, 75230 Paris, CEDEX 01, FRANCE
XX
DR   MD5; 387a65e94af100de3557c25ea22002b6.
XX
CC   Related sequences: M80302, L42517, M14097 & S51282
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..23096
FT                   /organism="Saccharomyces cerevisiae"
FT                   /chromosome="IV, left arm"
FT                   /sub_strain="RD005"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:4932"
FT   CDS_pept        <1..1340
FT                   /codon_start=3
FT                   /gene="STE7"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.1.37"
FT                   /note="D1525"
FT                   /db_xref="GOA:P06784"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06784"
FT                   /protein_id="CAA66332.1"
FT                   /translation="LDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQSPCVSSSSSLS
FT                   TPCIIDAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLEESLSPAAADLK
FT                   DTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIIN
FT                   QLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQR
FT                   GTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFG
FT                   VSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDT
FT                   PDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLIMKY
FT                   VSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH"
FT   CDS_pept        complement(1178..1486)
FT                   /note="D1530"
FT                   /db_xref="GOA:Q12047"
FT                   /db_xref="SGD:S000002317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12047"
FT                   /protein_id="CAA66333.1"
FT                   /translation="MIIFKNIVTLENWFVIYIIRRVYIYMNIALRKGCEKKCNMFLTNV
FT                   IACIQWVDLSDCFFSNLARSKASLLILLSSFILDFIFLHQCLNLSSLDGDTYFIIRS"
FT   CDS_pept        complement(1544..1900)
FT                   /note="D1533"
FT                   /db_xref="GOA:Q12082"
FT                   /db_xref="SGD:S000002316"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12082"
FT                   /protein_id="CAA66334.1"
FT                   /translation="MSNILAVFNPPPQRELEKEETMDCVPCQVMSTMFSVGFGSYLASG
FT                   KPFKYGKKEAKRGISLTEFEKRNPQWWKVTLRSFGGLLIAFGFVRGTEGWLWHKNKEYK
FT                   NYKKLSNDGETQAN"
FT   CDS_pept        2230..3798
FT                   /note="D1536"
FT                   /db_xref="GOA:Q12510"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR033052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="SGD:S000002315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12510"
FT                   /protein_id="CAA66335.1"
FT                   /translation="MPELTEFQKKRLENIKRNNDLLKKLHLSGVASQIKHEAGVLEKSR
FT                   APAKKKQKTTNTRATKSASPTLPTRRSRRLRGESADDVKGIPNVNDNQLLKMGSPDGQD
FT                   KNFIDAIKEKPVIGDVKLSDLIKDEDESALLEKFKRFNNGNFSSGDFFEEIKKRQGDVT
FT                   GMDEFDLDLYDVFQPNEIKITYERISATYFHPAMEKKLIIAGDTSGTVGFWNVRDEPLA
FT                   DSEEDRMEEPDITRVKLFTKNVGRIDCFPADTSKILLTSYDGSIRSVHLNNLQSEEVLT
FT                   LKNEYDDSLGISDCQFSYENPNVLFLTTLGGEFTTFDTRVKKSEYNLRRLADKKIGSMA
FT                   INPMRPYEIATGSLDRTLKIWDTRNLVKKPEWSQYEDYPSHEIVSTYDSRLSVSAVSYS
FT                   PTDGTLVCNGYDDTIRLFDVKSRDHLSAKLEPKLTIQHNCQTGRWTSILKARFKPNKNV
FT                   FAIANMKRAIDIYNSEGQQLAHLPTATVPAVISWHPLRNWIAGGNSSGKIFLFTDDSGT
FT                   IKQEE"
FT   CDS_pept        4085..5368
FT                   /gene="CLB3"
FT                   /product="cyclin B"
FT                   /note="D1539"
FT                   /db_xref="GOA:P24870"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="SGD:S000002314"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24870"
FT                   /protein_id="CAA66336.1"
FT                   /translation="MHHNSQSLSSGHIRSPEDENVAPIGNLKHRTGSLSHISSAHPRVA
FT                   LSDVTNIVATNSSNNSISKPKVAPIKERLDSAAIIEEERLDANSVAQRKEADHNDLLTD
FT                   REQEEPVEDDGESEEDEEEDQEPLLLQHYASDTLVWEHAFRTYYRTTLDPNDDDVYDVV
FT                   MVAELSNEIFEYMRKLEDLYKPNPYYMDKQPELRWSFRSTLIDWIVQVHEKFQLLPETL
FT                   YLCINIIDRYLCKEVVPVNKFQLVGAASLFIAAKYEEINCPTIKDFVYMSENCYSRNDL
FT                   LDAERTILNGLEFELGWPGPMSFLRRISKADDYEHDTRTLAKYLLESTIMDHRLVSAQP
FT                   SWLAAGAYFLSKIILGQNQWSLAHVYYSNYTQEQILPLATIILENCRYASKRHNAIWRK
FT                   YSSRRYLHSSQIVAKWIALAEHRVERSN"
FT   CDS_pept        5646..8351
FT                   /gene="MSH5"
FT                   /note="D1542"
FT                   /db_xref="GOA:Q12175"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR011184"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="SGD:S000002313"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12175"
FT                   /protein_id="CAA66337.1"
FT                   /translation="MSHEWLISASETMRSIGNGEGLRDKGAVVANNDGEFNEGDTNREE
FT                   DSSTIFSFDFDEEIVMCIDFSGGKLGCSILDYHTKTLKAFDQDYVVNKTTISSHDLIDD
FT                   ADMSSNDISLLLGLLIMEANPTVCLVPARLEDWIFDYIKTKCDEINCRLELQPIKRFKK
FT                   WDLLQSLQLRGHDNQTILNDILSNSKFTTTVTLGTVGCILANHEQLGEYNDSTASSNMV
FT                   TGRLVQNAFEDVIHGIRYIDIRDRMVLDENTISALHIFPTAHKLGHDKMMRNGFFSVFE
FT                   LFNQVSSDYARRILKSWLINPLTNKKRIETRYSIIRTLLDKQNAIIFSDLSQSIKRCPD
FT                   AFGFINQLRSGKSTLGTWSKVASFLEKGIAIFQLVSSLKLGSDEANILHDIKNKVDISA
FT                   LKECLRKVETVIDFDTSRDTKTLTINTGVDNRLDECRNIYNHLEGILLDVARETQIFLL
FT                   NTMPQEDCKTTKSLEKLVNAVYIPQLGYLVTISVLMEPLLDGIPNLQWEEIFRSSENIY
FT                   FKNGRVLELDETYGDIYGAISDFEIEILFSLQEQILRRKTQLTAYNILLSELEILLSFA
FT                   QVSAERNYAEPQLVEDECILEIINGRHALYETFLDNYIPNSTMIDGGLFSELSWCEQNK
FT                   GRIIVVTGANASGKSVYLTQNGLIVYLAQIGCFVPAERARIGIADKILTRIRTQETVYK
FT                   TQSSFLLDSQQMAKSLSLATEKSLILIDEYGKGTDILDGPSLFGSIMLNMSKSEKCPRI
FT                   IACTHFHELFNENVLTENIKGIKHYCTDILISQKYNLLETAHVGEDHESEGITFLFKVK
FT                   EGISKQSFGIYCAKVCGLSRDIVERAEELSRMINRGDDVVQQCGNLTEKEMREFQKNQE
FT                   IVKKFLSWDLDLETTTTSENLRLKLKNFLR"
FT   CDS_pept        complement(8498..10135)
FT                   /note="D1545"
FT                   /db_xref="GOA:Q12136"
FT                   /db_xref="InterPro:IPR018972"
FT                   /db_xref="PDB:5WLC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12136"
FT                   /protein_id="CAA66339.1"
FT                   /translation="MDEDDESIDEREDEEEEEEEELDGAAAYKKIFGRNLETDQLPEED
FT                   EENGMLDNENAWGSTKGEYYGADDLDDDEAAKEIEKEALRQQKKHLEELNMNDYLDEEE
FT                   EEEWVKSAKEFDMGEFKNSTKQADTKTSITDILNMDDEARDNYLRTMFPEFAPLSKEFT
FT                   ELAPKFDELKKSEENEFNKLKLIALGSYLGTISCYYSILLHELHNNEDFTSMKGHPVME
FT                   KILTTKEIWRQASELPSSFDVNEGDGSESEETANIEAFNEKKLNELQNSEDSDAEDGGK
FT                   QKQEIDEEERESDEEEEEEDVDIDDFEEYVAQSRLHSKPKTSSMPEADDFIESEIADVD
FT                   AQDKKARRRTLRFYTSKIDQQENKKTDRFKGDDDIPYKERLFERQQRLLDEARKRGMHD
FT                   NNGADLDDKDYGSEDEAVSRSINTQGENDYYQQVQRGKQDKKISRKEAHKNAVIAAREG
FT                   KLAELAENVSGDGKRAINYQILKNKGLTPKRNKDNRNSRVKKRKKYQKAQKKLKSVRAV
FT                   YSGGQSGVYEGEKTGIKKGLTRSVKFKN"
FT   CDS_pept        10134..10499
FT                   /note="D1551"
FT                   /db_xref="GOA:Q12394"
FT                   /db_xref="SGD:S000002311"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12394"
FT                   /protein_id="CAA66338.1"
FT                   /translation="MAKTSSSSSSSNREWSSSLLLSPKVDCPSKTFSLLEAKSSTSFKP
FT                   YGLISSPTSEVLVLFEPLRTILFYTPTLICFLFLQNFLYKSISEMSYDEMSFIIEFFFI
FT                   AEAQFENFSSALQSPIF"
FT   CDS_pept        complement(10630..11211)
FT                   /note="D1554"
FT                   /db_xref="GOA:Q12064"
FT                   /db_xref="SGD:S000002310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12064"
FT                   /protein_id="CAA66341.1"
FT                   /translation="MSTSLLFSLSPSSSSSMRLRASNSFPILNFFLDLDATPSLSSSSA
FT                   SFSELSAPLSIVSRPFCTRDDPLPSDLMNPLLKSPFSLTKFPAANGPLEITCVLFKYLA
FT                   IRLCWPPAPVTLLFLLLKCFLSLPLLDSSSSFTLDAAASLSSLDFLATAFGLNFNEGLA
FT                   DPPPLEEESFNDGKRPFPLLLLILNECYPA"
FT   CDS_pept        10655..11923
FT                   /gene="RPC53"
FT                   /product="DNA directed RNA polymerase III"
FT                   /EC_number="2.7.7.6"
FT                   /note="D1557"
FT                   /db_xref="GOA:P25441"
FT                   /db_xref="InterPro:IPR007811"
FT                   /db_xref="PDB:5FJ8"
FT                   /db_xref="PDB:5FJ9"
FT                   /db_xref="PDB:5FJA"
FT                   /db_xref="PDB:6CNB"
FT                   /db_xref="PDB:6CNC"
FT                   /db_xref="PDB:6CND"
FT                   /db_xref="PDB:6CNF"
FT                   /db_xref="PDB:6EU0"
FT                   /db_xref="PDB:6EU1"
FT                   /db_xref="PDB:6EU2"
FT                   /db_xref="PDB:6EU3"
FT                   /db_xref="PDB:6F40"
FT                   /db_xref="PDB:6F41"
FT                   /db_xref="PDB:6F42"
FT                   /db_xref="PDB:6F44"
FT                   /db_xref="SGD:S000002309"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25441"
FT                   /protein_id="CAA66340.1"
FT                   /translation="MSSNKGNGRLPSLKDSSSNGGGSAKPSLKFKPKAVARKSKEEREA
FT                   AASKVKLEEESKRGNDKKHFNNKNKRVTGAGGQQRRMAKYLNNTHVISSGPLAAGNFVS
FT                   EKGDLRRGFIKSEGSGSSLVQKGLETIDNGAESSENEAEDDDNEGVASKSKKKFNMGKE
FT                   FEARNLIEDEDDGESEKSSDVDMDDEEWRSKRIEQLFPVRPVRVRHEDVETVKREIQEA
FT                   LSEKPTREPTPSVKTEPVGTGLQSYLEERERQVNEKLADLGLEKEFQSVDGKEAAAELE
FT                   LLNADHQHILRKLKKMNNKPERFMVFQLPTRLPAFERPAVKEEKEDMETQASDPSKKKK
FT                   NIKKKDTKDALSTRELAGKVGSIRVHKSGKLSVKIGNVVMDIGKGAETTFLQDVIALSI
FT                   ADDASSAELLGRVDGKIVVTPQI"
FT   CDS_pept        12237..15230
FT                   /note="D1560"
FT                   /db_xref="GOA:Q12142"
FT                   /db_xref="InterPro:IPR007241"
FT                   /db_xref="SGD:S000002308"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12142"
FT                   /protein_id="CAA66342.1"
FT                   /translation="MERDEYQLPNSHGKNTFLSRIFGLQSDEVNPSLNSQEMSNFPLPD
FT                   IERGSSLLHSTNDSREDVDENDLRVPESDQGTSTEEEDEVDEEQVQAYAPQISDGLDGD
FT                   HQLNSVTSKENVLETEKSNLERLVEGSTDDSVPKVGQLSSEEEEDNEFINNDGFDDDTP
FT                   LFQKSKIHEFSSKKSNTIEDGKRPLFFRHILQNNRPQRDTQKLFTSSNAIHHDKDKSAN
FT                   NGPRNINGNQKHGTKYFGSATQPRFTGSPLNNTNRFTKLFPLRKPNLLSNISVLNNTPE
FT                   DRINTLSVKERALWKWANVENLDIFLQDVYNYYLGNGFYCIILEKILNICTLLFVVFVS
FT                   TYMGHCVDYSKLPTSHRVSDIIIDKCYSNSITGFTKFFLWMFYFFVILKIVQLYFDVQK
FT                   LSELQNFYKYLLNISDDELQTLPWQNVIQQLMYLKDQNAMTANVVEVKAKNRIDAHDVA
FT                   NRIMRRENYLIALYNSDILNLSLPIPLFRTNVLTKTLEWNINLCVMGFVFNESGFIKQS
FT                   ILKPSQREFTREELQKRFMLAGFLNIILAPFLVTYFVLLYFFRYFNEYKTSPGSIGARQ
FT                   YTPIAEWKFREYNELYHIFKKRISLSTTLANKYVDQFPKEKTNLFLKFVSFICGSFVAI
FT                   LAFLTVFDPENFLNFEITSDRSVIFYITILGAIWSVSRNTITQEYHVFDPEETLKELYE
FT                   YTHYLPKEWEGRYHKEEIKLEFCKLYNLRIVILLRELTSLMITPFVLWFSLPSSAGRIV
FT                   DFFRENSEYVDGLGYVCKYAMFNMKNIDGEDTHSMDEDSLTKKIAVNGSHTLNSKRRSK
FT                   FTAEDHSDKDLANNKMLQSYVYFMDDYSNSENLTGKYQLPAKKGYPNNEGDSFLNNKYS
FT                   WRKQFQPGQKPELFRIGKHALGPGHNISPAIYSTRNPGKNWDNNNNGDDIKNGTNNATA
FT                   KNDDNNGNNDHEYVLTESFLDSGAFPNHDVIDHNKMLNSNYNGNGILNKGGVLGLVKEY
FT                   YKKSDVGR"
FT   CDS_pept        complement(15466..17898)
FT                   /note="D1566"
FT                   /db_xref="GOA:Q99207"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="PDB:5WLC"
FT                   /db_xref="SGD:S000002307"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99207"
FT                   /protein_id="CAA66343.1"
FT                   /translation="MAGSQLKNLKAALKARGLTGQTNVKSKNKKNSKRQAKEYDREEKK
FT                   KAIAEIREEFNPFEIKAARNKRRDGLPSKTADRIAVGKPGISKQIGEEQRKRAFEARKM
FT                   MKNKRGGVIDKRFGERDKLLTEEEKMLERFTRERQSQSKRNANLFNLEDDEDDGDMFGD
FT                   GLTHLGQSLSLEDELANDEEDFLASKRFNEDDAELQQPQRKKTKAEVMKEVIAKSKFYK
FT                   QERQKAQGIMEDQIDNLDDNFEDVMSELMMTQPKKNPMEPKTDLDKEYDIKVKELQLDK
FT                   RAAPSDRTKTEEEKNAEAEEKKRELEQQRLDRMNGMIELEEGEERGVEDLDDGFWENEE
FT                   DYEDDNDGIADSDDDIKFEDQGRDEGFSQILKKKNISISCPRTHDALLDQVKKLDLDDH
FT                   PKIVKNIIKAYQPKLAEGNKEKLGKFTAVLLRHIIFLSNQNYLKNVQSFKRTQNALISI
FT                   LKSLSEKYNRELSEECRDYINEMQARYKKNHFDALSNGDLVFFSIIGILFSTSDQYHLV
FT                   ITPALILMSQFLEQIKFNSLKRIAFGAVLVRIVSQYQRISKRYIPEVVYFFQKILLTFI
FT                   VEKENQEKPLDFENIRLDSYELGLPLDVDFTKKRSTIIPLHTLSTMDTEAHPVDQCVSV
FT                   LLNVMESLDATISTVWKSLPAFNEIILPIQQLLSAYTSKYSDFEKPRNILNKVEKLTKF
FT                   TEHIPLALQNHKPVSIPTHAPKYEENFNPDKKSYDPDRTRSEINKMKAQLKKERKFTMK
FT                   EIRKDAKFEARQRIEEKNKESSDYHAKMAHIVNTINTEEGAEKNKYERERKLRGGKK"
FT   CDS_pept        18236..19573
FT                   /note="D1572"
FT                   /db_xref="GOA:Q12250"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="InterPro:IPR040896"
FT                   /db_xref="PDB:3J47"
FT                   /db_xref="PDB:3JCK"
FT                   /db_xref="PDB:3JCO"
FT                   /db_xref="PDB:3JCP"
FT                   /db_xref="PDB:4CR2"
FT                   /db_xref="PDB:4CR3"
FT                   /db_xref="PDB:4CR4"
FT                   /db_xref="PDB:5A5B"
FT                   /db_xref="PDB:5MPB"
FT                   /db_xref="PDB:5MPC"
FT                   /db_xref="PDB:5MPD"
FT                   /db_xref="PDB:5MPE"
FT                   /db_xref="PDB:5WVI"
FT                   /db_xref="PDB:5WVK"
FT                   /db_xref="PDB:5ZMR"
FT                   /db_xref="PDB:6FVT"
FT                   /db_xref="PDB:6FVU"
FT                   /db_xref="PDB:6FVV"
FT                   /db_xref="PDB:6FVW"
FT                   /db_xref="PDB:6FVX"
FT                   /db_xref="PDB:6FVY"
FT                   /db_xref="PDB:6J2C"
FT                   /db_xref="PDB:6J2N"
FT                   /db_xref="PDB:6J2Q"
FT                   /db_xref="PDB:6J2X"
FT                   /db_xref="PDB:6J30"
FT                   /db_xref="SGD:S000002306"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12250"
FT                   /protein_id="CAA66344.1"
FT                   /translation="MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKK
FT                   TRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYL
FT                   KSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCEL
FT                   QVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYN
FT                   LLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLI
FT                   HKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWED
FT                   LQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKI
FT                   VNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGLQAK"
FT   CDS_pept        20062..21537
FT                   /note="D1575"
FT                   /db_xref="GOA:Q12342"
FT                   /db_xref="InterPro:IPR018556"
FT                   /db_xref="SGD:S000002305"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12342"
FT                   /protein_id="CAA66345.1"
FT                   /translation="MILDPLSPNIENHTQDEIIEFWEKTESIANIPKENLDESHVNSSL
FT                   VAYLKFATDSYKVFINTDRDLYRMSLILLESSLFEFKKEFCLSKLQSLLNIDLLEMNMK
FT                   FIIVYILLCEAKKNVYSLEIMLKFQGFTVFYNTLYTQFAYLSKYGKERTVASKHQYNSN
FT                   NSSTGTSLDSLDRSLTDIDLGIIDEMKQISTVLMDLLFQIMKYCKCVIANLQIVDDFFV
FT                   YYMMESMRSDTMDDMFNNAEFKLLLALNEQYMMFAKEYDIENKVYKYLINGSVSRCFTE
FT                   LLLLKFNRASDPPLQIMMCKIIYLILTPRGDYSPMNFFYTNDLRVLIDVLIRELQNISE
FT                   DEEVLRNTLLRVLIPLLKNTQLSKTHYRKDDLNKLLNYLSTLDNICVDSPALHEHQVTV
FT                   ALSRKCLQQIPWLETPSTPSDGGSSVSSNNTSRNSSIVALGTPDNQNILARKGHLYSNR
FT                   ELDVSAESLTKRKAKAPPPPPPPPPSRKCGTPK"
FT   CDS_pept        complement(21883..>23096)
FT                   /codon_start=3
FT                   /gene="RET1"
FT                   /product="non-clathrin coat protein"
FT                   /note="D1578"
FT                   /db_xref="GOA:P53622"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PDB:3MKQ"
FT                   /db_xref="PDB:3MV2"
FT                   /db_xref="PDB:3MV3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53622"
FT                   /protein_id="CAA66346.1"
FT                   /translation="NFVQRPVISKPLEKWPLKEAELSYFEKAVLGQIDDLTIDDETPAV
FT                   NTTQEQEEPLGEENFNDEDIGEDEGAWDLGDEDLDVGEELPEEVEQGEITSPAQEVETA
FT                   IWIKNSKLPAVLVAAGAFDAAVQALSKQVGVVKLEPLKKYFTNIYEGCRTYIPSTPCEL
FT                   PAQLGYVRAYDDTVSEDQILPYVPGLDVVNEKMNEGYKNFKLNKPDIAIECFREAIYRI
FT                   TLLMVDDAEDEKLAHKILETAREYILGLSIELERRSLKEGNTVRMLELAAYFTKAKLSP
FT                   IHRTNALQVAMSQHFKHKNFLQASYFAGEFLKIISSGPRAEQARKIKNKADSMASDAIP
FT                   IDFDPYAKFDICAATYKPIYEDTPSVSDPLTGSKYVITEKDKIDRIAMISKIGAPASGL
FT                   RIRV"
XX
SQ   Sequence 23096 BP; 7383 A; 4318 C; 4314 G; 7081 T; 0 other;
     cgttggatgc gtttggtgat gaccaagcta tatcgaaacc aaacactgtg gtaatacagc        60
     aaccgcaaaa tgaacctgtt ttagttctgt cttctctatc acaatccccg tgtgtatcat       120
     catcatcatc tttgtccacg ccatgcatta tagatgcgta cagtaataat ttcggattat       180
     cgccatcatc cacgaattct actccctcta cgattcaggg attgtccaat attgcaacac       240
     cagttgaaaa cgaacattcg atatcactac cacctttgga ggaaagccta tcgccagccg       300
     cagcagatct gaaagatacg ttgtcgggaa cttcaaatgg taattatata caactccagg       360
     acttggttca gttggggaaa attggtgctg gaaattctgg aactgtggtg aaggcactac       420
     atgttcctga ttccaaaata gttgccaaaa aaaccattcc tgtggaacag aataacagta       480
     caatcatcaa ccaattagtt agggaattat ctatcgtcaa aaacgttaag ccccatgaaa       540
     acattatcac cttctatgga gcttattata accagcatat aaataatgaa atcataattt       600
     taatggaata ctctgattgt ggttctttag ataaaatact gtccgtttat aaaaggtttg       660
     ttcaaagagg gactgtttcg agtaagaaaa cctggttcaa cgaattaaca atatcaaaaa       720
     tagcgtatgg cgtactaaat ggcttggatc atttgtaccg acaatataag atcattcatc       780
     gtgatatcaa gccttccaat gttctgatta atagtaaggg gcagattaag ttatgtgatt       840
     ttggagtttc caaaaaacta ataaattcta tcgctgatac atttgttgga acgtccactt       900
     atatgtcacc agagaggata caaggaaacg tttattctat caaaggggac gtttggtcat       960
     tgggcttaat gatcatcgag ctggtaactg gagagtttcc cctaggtggg cataacgata      1020
     cacctgatgg catattggat ttgctgcaac gtattgtcaa cgagccttca ccaagattac      1080
     ccaaagaccg tatctattcc aaggaaatga cagattttgt caataggtgt tgtattaaga      1140
     atgaaaggga aaggtcatcg attcatgaat tgctacatca tgatcttata atgaaatacg      1200
     tatcaccgtc taaagatgat aaatttagac attggtgtag aaaaataaaa tctaaaataa      1260
     aggaagacaa gagaattaaa agagaagcct tggaccgtgc caagttagaa aagaaacaat      1320
     cggaaagatc aacccattga atgcatgcga taacattagt taggaacata ttgcactttt      1380
     tttcacatcc ctttctcaaa gctatattca tatatatata gactctcctg attatgtaaa      1440
     tcacaaacca attttctaat gtaacaatat ttttaaaaat aatcatcaaa gtagcacttt      1500
     atgtacagaa aatttcacga ttgagagaag cttgcgaata atactagtta gcctgtgttt      1560
     caccatcgtt acttaatttc ttatagttct tatattcttt atttttatgc cacaaccaac      1620
     cttcggttcc tctaacgaaa ccgaaggcga ttaataaccc accgaagcta cgtaaagtta      1680
     ctttccacca ttgtgggttt cttttttcaa attcagtcag agaaatgcct cttttggctt      1740
     cttttttacc atacttgaat ggtttcccag atgccaagta tgagccaaat ccaacagaaa      1800
     acatagtgct catgacttga caaggaacgc aatccatagt ctcttctttt tccagctccc      1860
     tttgtggtgg agggttgaac actgccaaaa tattactcat tgtttttcac cacttgctgt      1920
     ttctctctaa gcggtgtttt gtttcctact tggtggcaca caatgactgt actcgcttta      1980
     tatgctcgta ccttttttca aaagcccatc gttaattttt cacccgagga ccccatatta      2040
     cgcgtttttt gttaatgttc aatttctgac atgttacaat tataataacg ccaaaagagg      2100
     taaatgtata tttgaacaat tgttaaagag aagataaaaa ccctttaatc ttgcatttgt      2160
     cgtcaatagt acacaatagg cgatctattt tagtacggca attaaaagaa agctgctttt      2220
     cagtcaagaa tgccggaatt aacagaattt cagaaaaaac gtttagagaa catcaaaagg      2280
     aataacgatt tattgaaaaa actccatttg tctggagtag catctcaaat taagcacgag      2340
     gctggggtgt tggaaaaatc tagagctcct gcaaaaaaga aacaaaaaac aactaatacc      2400
     agagcaacca agtctgcgag tcccacttta cctacacgaa gatcaagaag gctaaggggt      2460
     gagtctgcag acgatgtgaa aggaataccc aatgtgaacg ataatcagtt gcttaaaatg      2520
     ggttctccag atggccagga taagaatttt atagacgcaa taaaggagaa acctgtaata      2580
     ggagatgtga aattaagtga tctgatcaag gatgaagacg aaagtgccct tttagagaaa      2640
     ttcaagaggt ttaataacgg aaacttttct tctggtgatt tctttgaaga aataaaaaag      2700
     agacagggtg acgttacggg gatggacgaa tttgatttgg atctatatga cgtttttcaa      2760
     ccgaacgaaa ttaagattac atacgaaaga atctctgcca cttacttcca tcctgctatg      2820
     gaaaaaaagc taataattgc aggtgataca agcggtactg tgggtttttg gaacgttaga      2880
     gatgaaccac tagctgacag cgaagaggac cgaatggaag aacccgatat caccagagtg      2940
     aaactattta ccaaaaacgt cggccgtatt gattgcttcc ctgcggacac atcgaagata      3000
     ttgctcacct cttacgacgg aagcatcagg tcagttcact tgaataactt acagagtgaa      3060
     gaggttctca ccttgaaaaa tgaatatgac gattcactgg gtatcagcga ttgccagttt      3120
     agctacgaaa acccaaatgt tttattcctc accacattag gtggtgaatt caccacgttt      3180
     gacacaagag taaaaaaatc agagtataat ctgcgaagac tcgcagacaa gaagatcggg      3240
     tctatggcaa taaatcccat gagaccctac gagattgcca ccggatcact tgatagaaca      3300
     ctcaaaatct gggatacaag aaaccttgtt aaaaagccag agtggtcaca atatgaagac      3360
     tatcccagtc atgaaattgt ctccacatat gactcaagat tgagcgtctc tgcagtttct      3420
     tactcaccga cagatggcac cttagtgtgc aatggctatg acgataccat ccgcttattc      3480
     gatgtcaaga gtagggatca cctttctgcg aagttggagc ccaaactaac gattcagcac      3540
     aattgccaaa caggaagatg gacaagcatc ctcaaggcca ggttcaagcc gaacaagaat      3600
     gtttttgcaa tagctaacat gaagcgcgcc atcgacatat acaacagcga aggccagcaa      3660
     ctggctcacc tacccacagc tactgtccca gctgtaatta gttggcaccc gctgcgaaac      3720
     tggattgcag gtggtaattc tagcggcaaa atattcctct ttactgatga ctccggaacc      3780
     ataaagcagg aagaatgaaa acatctcagt tacccgcact gccttttttc tctcccgctt      3840
     ttcagcagaa cgaggcgaca agcgaaggaa caaaacaaaa caaaagaaaa caaaaatatt      3900
     gaaatgcaag aacatggaca cataaaaaca tttttgatcc ggtcgaaaga aaacgatcag      3960
     aaatttttag ctgcttgctt agaagaaaag aaaagaaaat tgcagagaaa aagctattta      4020
     ttgtttctgt ccttcgcttt aaaacataga gatattttgt cctttttatc attgcttatt      4080
     ataaatgcat cataactcac agtctttgag ctctggacac atcaggagcc ccgaggatga      4140
     aaatgtggca cctataggta atcttaaaca caggactgga tccctcagtc atatttcatc      4200
     tgcgcacccg agggtcgcac ttagcgacgt taccaatata gttgcgacaa actctagcaa      4260
     caacagcata agtaagccaa aagtcgcccc aattaaagaa agattggatt cagctgcgat      4320
     aattgaggaa gaaaggctgg atgcgaatag tgttgcacag agaaaagaag ctgatcataa      4380
     cgatttgtta acggacaggg aacaagagga acccgttgaa gacgacggag aaagcgaaga      4440
     ggatgaagaa gaagaccagg agcctctact gttgcaacat tatgctagtg atacattggt      4500
     ctgggagcat gcatttagaa cttactatag aactacatta gatcccaatg atgatgacgt      4560
     gtacgatgtg gtcatggttg ccgaattatc taatgagata ttcgagtata tgaggaaatt      4620
     ggaagacctg tataaaccca acccgtacta catggataaa caaccagagt taagatggtc      4680
     gtttcgaagc acactgattg attggatcgt ccaagtacat gaaaaatttc aacttttacc      4740
     tgaaactcta tatctctgca ttaatataat agacagatat ctgtgcaaag aagttgttcc      4800
     tgtaaataag ttccaacttg tgggtgcagc ctcactcttc attgctgcta aatatgagga      4860
     aatcaactgt cctacaatca aggatttcgt atacatgtca gaaaactgct actcaaggaa      4920
     cgacctgctg gacgcagaaa gaactatttt gaacggctta gaatttgaat tgggttggcc      4980
     tggtccgatg tcatttttac gaagaatcag taaggcagac gattacgagc atgatacgag      5040
     aacactggcc aaatatctat tggaatccac aataatggac catcgactgg tttccgctca      5100
     acctagttgg ttagctgccg gtgcatactt tctaagtaag attattctgg gccaaaatca      5160
     gtggtctctg gcgcacgtct actattccaa ttatacacaa gaacaaattc ttccgttggc      5220
     caccattatt ttagaaaatt gcagatatgc ctctaaacgt cataacgcca tatggagaaa      5280
     atattcttca cgtcgttatt tgcattcttc acagatcgta gcgaagtgga tagcattagc      5340
     tgaacacaga gtagaaagat ctaactaaaa agcctcagct cgagacatgg catcaacaaa      5400
     ggaaaaagga ttcattaccg tcttttgcac acaaaaactt taatcatcag taataaacat      5460
     atgtaacttt ttaaccttaa aacatactaa tctccgtact ttttttaaag catccacaat      5520
     ccatatggat atgacgcgaa attagctcgg cggttaatta ttaaaaaatt gaagctaaaa      5580
     tcaaggttaa caaaacaact cattcaaaat aacttactca ttcatatact gccaccaaat      5640
     ggaatatgtc ccatgaatgg ctcataagcg catcggaaac aatgagaagc attggtaatg      5700
     gggaaggttt gcgggataaa ggtgctgtcg ttgccaacaa tgacggagaa tttaacgaag      5760
     gtgatacaaa tcgtgaagag gatagctcta ccattttctc cttcgatttt gacgaggaga      5820
     ttgtaatgtg tattgacttt tctggaggaa aactcgggtg ttctatttta gattatcata      5880
     ccaagacttt gaaagcgttt gaccaggact acgtggtcaa taaaacaaca atttcgtctc      5940
     atgatcttat cgatgatgca gatatgtctt caaacgacat aagtctgtta cttggacttt      6000
     taataatgga agcaaaccca actgtatgcc tagtgccggc aagattggag gattggattt      6060
     tcgactacat taagacaaaa tgcgatgaga taaactgtag gctagaacta caaccaataa      6120
     aacgtttcaa aaaatgggac ttattgcagt cattgcagtt aaggggtcat gataatcaga      6180
     ctatattgaa cgacatatta tcaaatagca aatttaccac cacagtcacc ttaggtacag      6240
     tgggatgcat ccttgcaaat catgaacaac ttggtgaata caatgacagt actgcttcaa      6300
     gtaatatggt aacaggacga ttagttcaga atgcttttga agatgtgata catggcataa      6360
     ggtatatcga cataagggat cggatggtac tggatgaaaa tactatatcg gctttgcata      6420
     tttttccaac agctcataaa ctgggccatg ataagatgat gagaaatggt ttctttagtg      6480
     tatttgaact attcaatcaa gtgtcttcgg actacgccag gagaattttg aagtcttggc      6540
     ttattaaccc attaaccaat aaaaaacgga tagaaacaag atacagcatc ataagaacct      6600
     tattggataa acaaaacgcc atcattttta gtgaccttag ccaatcaata aaaagatgtc      6660
     cagacgcttt tgggtttata aatcagttaa gaagtggtaa atcgacatta gggacatggt      6720
     ccaaggttgc aagtttttta gaaaaaggaa tagctatatt tcaactggtg tcgtccttga      6780
     aattaggttc agacgaagcc aacattttac atgatatcaa aaataaggtt gatatatcag      6840
     ctttaaagga atgtttgaga aaagtagaaa cggtaataga ttttgacaca tcaagagata      6900
     ccaagacgct cacgataaat acgggggttg acaacagatt agacgaatgc agaaatattt      6960
     ataatcattt ggaagggatc ttactggatg tcgcaagaga aactcaaatt tttttactga      7020
     atactatgcc tcaagaagat tgtaagacaa caaagagttt agaaaagtta gtgaatgctg      7080
     tttatattcc ccaattagga tacttagtaa ccattagcgt cttaatggaa cctttattgg      7140
     atggcattcc aaaccttcaa tgggaagaga tctttaggag ttcagaaaat atatacttca      7200
     aaaatggcag ggttcttgag ctggatgaaa catacggcga tatttatggc gcgatttcag      7260
     attttgaaat tgaaatcctg ttttccttac aagaacaaat tctgagaaga aagactcaac      7320
     tcactgctta caatatactg cttagtgaac tggaaatatt attatcgttc gctcaagtgt      7380
     ctgctgaaag gaattatgca gagcctcaat tggtggaaga tgagtgcata ttggaaatta      7440
     ttaacggaag acatgctttg tatgaaacat tccttgataa ttatatcccc aatagcacaa      7500
     tgattgatgg cgggctattt tctgaattaa gttggtgtga acaaaataaa ggaagaatca      7560
     ttgtagtcac tggcgctaat gcatctggaa agtctgtata tcttacacag aatggtttaa      7620
     ttgtgtactt ggcacaaatt ggttgttttg ttccagcaga gagagcgaga attggaatag      7680
     cggataaaat attaactaga atcaggactc aagaaactgt ttataagact caaagttcct      7740
     ttttgctaga ttctcaacaa atggcaaaat cactgagttt ggccactgaa aaaagtctca      7800
     ttttaattga tgaatacggc aaaggtactg atattttaga tggaccttca ctatttggtt      7860
     ccataatgct caatatgtcc aagagtgaaa aatgtccacg cataatcgca tgtacacact      7920
     ttcatgaact atttaacgaa aatgtactca cagagaatat aaaaggtatc aaacattact      7980
     gcactgatat acttatcagc caaaaatata atcttttaga aacagcacat gtcggagaag      8040
     atcatgaaag tgagggaatc acattcctat tcaaagtaaa ggaggggatc tcaaagcagt      8100
     catttggcat atattgcgca aaagtatgtg gtttgagcag agatattgtg gaaagggctg      8160
     aagaactatc tcgcatgatt aatagaggcg atgacgtagt tcagcaatgt ggaaatctga      8220
     ccgaaaagga gatgagagaa ttccaaaaga atcaggaaat agtgaaaaag tttttatctt      8280
     gggatttgga tctcgaaact acaacaactt ccgagaatct caggcttaaa ttgaaaaatt      8340
     tccttcgcta atatatcaaa gaataaaaaa acgcttactt gtaacatatt taagttaata      8400
     aatgtcaagc ggttgctctt ttcttataaa aatatattgt atgggtacaa aaattttgac      8460
     accactactt gggtaaatac tacatatgta aattttttta attcttgaat ttaacagacc      8520
     tcgtcaaacc cttcttgata cctgtctttt caccttcata gacgccagat tgaccaccag      8580
     aataaactgc acgaaccgac ttgagtttct tttgtgcctt ttggtatttc tttctcttct      8640
     tgacacgaga gtttctgtta tccttgtttc ttttaggcgt tagacccttg ttctttaaaa      8700
     tttgataatt aatggcacgc ttaccatcac ctgagacatt ttcagccaat tccgccaatt      8760
     ttccttccct tgcagcaata acagcattct tatgagcctc tttacgagat attttcttgt      8820
     cttgtttacc tctctgaacc tgttgataat aatcgttctc gccttgagtg ttgatgctcc      8880
     tagacacagc ttcatcttca gaaccgtaat ccttatcgtc taggtcagca ccattattat      8940
     catgcatacc acgtttacga gcttcatcca acagacgttg ctgcctttca aataaacgtt      9000
     ccttatatgg aatatcatca tcacctttga atctatccgt ctttttattt tcttgttgat      9060
     caattttcga agtatagaaa cgcaaagttc ttctacgagc ttttttgtct tgtgcgtcca      9120
     catcagcaat ctcagattca atgaaatcat cagcttcagg cattgatgat gttttcggtt      9180
     tagaatgcag acgtgattgt gctacgtact cttcaaaatc gtcaatatca acatcttctt      9240
     cttcttcttc ttcatcgctt tctctttctt cttcatcaat ttcttgcttt tgttttcctc      9300
     catcctctgc atcagaatct tcactgtttt gcaactcatt cagcttcttt tcgttaaagg      9360
     cctcaatgtt tgcggtttct tcactttcag aaccatctcc ttcattcaca tcaaaactag      9420
     atggcaattc gctggcttgc ctccaaatct cttttgtcgt taaaatcttt tccatgaccg      9480
     gatgtccctt catagatgtg aaatcttcat tattatggag ttcgtgcaac aagatactat      9540
     agtaacatga tattgtgcct aggtaacttc caagtgcaat tagctttaat ttattgaact      9600
     cattttcctc agatttcttt aattcgtcaa actttggagc taattctgtg aattcttttg      9660
     aaagtggagc aaattcagga aacattgtcc ttaaatagtt atcccttgct tcgtcatcca      9720
     tatttagaat atccgttatg gaagttttag tatcagcctg cttggtcgag ttcttaaatt      9780
     cacccatgtc aaattctttg gcacttttga cccactcttc ttcttcttct tcatctaagt      9840
     aatcgttcat attaagttct tccagatgct tcttttgttg tcgtaaagct tccttttcta      9900
     tttccttagc agcttcgtca tcatctaaat catcagcccc ataatattct ccttttgtgg      9960
     acccccaggc attctcgttg tctaacatac cattctcttc atcttcctca ggaagctggt     10020
     cagtttctaa gtttctacca aatattttct tataggctgc agcaccatct agttcctctt     10080
     cctcttcttc ttcctcatct tctctttcat ctattgactc atcatcttca tccatggcta     10140
     agacttcttc ctcatcttcg tcttctaaca gagaatggtc atcatcttta ttactgtcgc     10200
     caaaggtgga ttgtccaagt aaaacctttt cccttttaga agcaaaatca tcaacttcgt     10260
     ttaaaccata cggattaatc tcatccccaa cttcagaggt cttagttctg tttgagcctt     10320
     tgcgtaccat attattctat acacccactc taatatgttt tctcttcctc caaaactttt     10380
     tgtataaaag catcagtgag atgagctatg atgagatgag cttcattatt gaattttttt     10440
     tcattgcaga agcgcagttt gaaaattttt catccgccct gcaaagtcca attttttgat     10500
     cagcagaaga taatgaccag agaattatgg tattcaagag aacaattcaa aagaggacag     10560
     ctagaaagat attgaggtat ttataatttg ctagactaac cgaaagtcga agcgtaatct     10620
     tgttttttat taagcgggat agcattcatt aagtatgagc agtaataaag gaaatgggcg     10680
     cttgccatca ttaaaagatt cctcctccaa tggaggagga tctgccaagc cctcattaaa     10740
     gtttaaacca aaagcagttg caagaaagtc caaggaagaa agagaagcag ctgcgtccaa     10800
     agtaaagcta gaggaggaat ctaagagagg taatgacaag aaacatttca ataacaagaa     10860
     taaaagagta accggcgctg gcggccagca aaggcgaatg gccaaatact taaataacac     10920
     acacgttatc tctagcggtc cattggcggc tgggaacttt gtaagtgaga agggtgattt     10980
     gagaagagga ttcatcaaat cagaaggaag cgggtcatct cttgtgcaaa agggcctgga     11040
     aactattgac aatggtgctg agagctctga gaatgaggca gaagacgatg ataatgaagg     11100
     tgtagcgtcc aaatctaaga agaagttcaa tatgggaaaa gaattcgagg cacgcaatct     11160
     catagaggac gaagatgacg gcgaaagtga aaagagcagt gacgtcgaca tggatgacga     11220
     agaatggaga tctaaacgga ttgaacagtt attccctgtg agacctgtcc gcgtaagaca     11280
     cgaagacgtt gaaactgtca aaagagaaat acaagaagct ctttcagaaa agccaactcg     11340
     tgaaccaacc cccagtgtga agacagagcc tgtcggaacc ggattacaat cttatttgga     11400
     agaaagagaa aggcaagtca atgagaaact ggcagatctt ggacttgaaa aggagtttca     11460
     atcggttgat gggaaagaag cggccgctga gttggaatta ttaaatgcag atcatcagca     11520
     tatattacga aaactaaaga aaatgaataa taaaccagaa agattcatgg tattccagtt     11580
     acctactagg ttaccagctt ttgaaagacc cgctgtgaaa gaagaaaaag aagacatgga     11640
     aacccaggct agcgaccctt caaagaagaa gaagaatatt aaaaagaagg acacgaagga     11700
     tgctttgtct actagagaac ttgccggcaa ggttgggtct atacgggttc acaaatctgg     11760
     aaaactttcc gtgaaaattg gaaatgtggt gatggatatt ggcaaaggtg ccgaaaccac     11820
     atttttacaa gatgttatag cattaagtat cgctgatgat gcatcctcag cggaacttct     11880
     aggccgtgtg gacggtaaaa tagtagtcac acctcaaatc taatcgcact cgcatctgtc     11940
     gagtatataa atgaatatac acagtcataa atacttctag aacaaattac actaattaag     12000
     atgcttagat tcccattcaa aaggtactat tgacgtcttg tcttctacaa tttctcatcc     12060
     tctttgaaca ttggtaatgt tattctagtt attgttaccc agtttcggaa ctttagggga     12120
     gccacacttt aaacaaaaag aagcgccata accaccgtga agtaatgagt atctcacttt     12180
     gataagaaga catttaagaa cagcctgaaa tatcaaaatc acggaattat taggttatgg     12240
     agagagatga ataccagtta cccaactctc atgggaagaa tactttctta tcgcgaatat     12300
     ttggtttaca atcggatgaa gttaatcctt ctcttaatag ccaggagatg agcaacttcc     12360
     ctttaccaga catagagaga ggctcatctt tattgcattc tactaacgac agccgcgaag     12420
     atgtagatga gaatgactta cgtgttcctg agtctgacca aggcactagt acagaagaag     12480
     aggatgaagt agatgaagag caagtccagg cgtatgctcc acagattagt gatggattgg     12540
     atggagacca ccagctaaat tctgtaacga gcaaagaaaa tgtacttgaa acggaaaaaa     12600
     gcaatttaga aagactggtt gaaggctcta ccgatgattc tgtgcccaaa gtcggacagc     12660
     tttcgtcaga agaagaagag gataatgagt tcataaataa tgatggattt gatgacgata     12720
     cgcccctttt tcaaaaaagc aagattcatg aatttagctc taagaaaagc aatactatag     12780
     aggacggtaa acgacctttg tttttcaggc atatcttaca gaataaccgc cctcaacgtg     12840
     atacccaaaa gctatttact tcgtcgaacg ccattcacca tgataaggac aagagtgcaa     12900
     ataatggtcc ccgtaacatt aatggtaatc aaaagcatgg cactaaatac tttggtagtg     12960
     ctacacaacc tcggtttacc ggttcgccct taaataatac aaacaggttc actaaattgt     13020
     ttccattaag aaagccaaat ttactgagca atatatccgt tttaaacaat accccggaag     13080
     atagaatcaa tacgttgagc gtgaaagagc gggctctgtg gaaatgggca aacgtagaaa     13140
     acctcgatat atttcttcaa gatgtttaca attattatct gggaaatggg ttctattgca     13200
     tcatactgga aaaaatattg aatatatgca ctttgctttt tgttgttttt gtttctacat     13260
     atatgggtca ctgtgttgac tactccaaat taccgactag tcaccgggtt tcggatatta     13320
     ttatcgacaa gtgttattct aatagtataa cggggttcac aaagtttttc ctttggatgt     13380
     tttatttctt cgtgattctc aaaattgttc aactctactt tgatgttcaa aaattatcag     13440
     aattacaaaa cttttacaag tatcttttaa atatatcgga tgacgaactt caaactttgc     13500
     cctggcaaaa tgtgatacag cagctaatgt acttgaagga tcaaaacgct atgacggcaa     13560
     atgttgtgga agtcaaagcc aagaatagaa tcgacgcgca tgacgttgcc aatagaatca     13620
     tgagaagaga aaactatctc atagcacttt acaatagcga catcctgaat ttatccttgc     13680
     ctattccatt atttaggacc aacgttctga caaaaacact agaatggaat attaatttat     13740
     gcgtcatggg ctttgtgttc aacgagtccg gatttattaa acaaagtatt ttaaaacctt     13800
     ctcaaagaga attcacgaga gaagaattac aaaaaagatt catgctggca ggatttctta     13860
     atattatatt ggcaccattt ctggtcacat actttgtttt gctttatttt ttcagatatt     13920
     ttaatgagta taaaacttct cctggatcta ttggtgctcg tcaatacaca ccaattgctg     13980
     aatggaaatt ccgtgagtac aatgaacttt accatatttt taagaaaaga ataagtttga     14040
     gcacaacctt agctaacaag tatgttgatc agttcccgaa ggaaaagacc aatttgtttc     14100
     tgaaatttgt ttcctttatt tgtggatcat ttgtggccat tttagctttt ctcactgtat     14160
     tcgatccaga aaacttttta aactttgaaa tcacctcgga cagatctgtc attttctaca     14220
     ttactattct gggtgctata tggtctgtaa gtagaaatac aataacccag gagtaccatg     14280
     ttttcgaccc cgaagagacg ctcaaggagt tgtatgaata tacacactat ctaccaaagg     14340
     aatgggaagg aagatatcac aaagaggaaa tcaaactaga gttctgtaaa ttgtacaact     14400
     tgagaatagt aatacttttg agggaactca ctagcctgat gataacaccg tttgtacttt     14460
     ggttttcgtt gccctcgtca gccggcagga ttgtagattt cttcagagag aattctgaat     14520
     atgtggacgg attaggttac gtttgcaagt atgctatgtt taacatgaaa aacatagacg     14580
     gtgaagatac acacagcatg gatgaagaca gtttaacgaa aaagattgcc gtgaacggaa     14640
     gtcatacact caacagtaaa cgaaggagta aatttaccgc cgaagaccat agcgataaag     14700
     atttggcaaa taataaaatg ttacaatcat atgtatattt tatggatgat tattccaaca     14760
     gtgaaaactt aacagggaag taccaattgc ctgcaaaaaa aggctatccg aataatgaag     14820
     gcgattcatt tctcaacaat aagtattctt ggagaaagca atttcagcca ggtcaaaagc     14880
     cggagctatt tagaataggt aagcatgctc tcggccctgg ccataatatt tcccctgcta     14940
     tatattctac aaggaatccc ggcaagaact gggataacaa taataatggt gatgacatta     15000
     agaacgggac caataatgct acagctaaaa atgatgacaa taatggcaat aatgatcatg     15060
     aatacgtact aacagagtct ttccttgatt cgggcgcatt ccctaatcat gatgtaatag     15120
     accataataa aatgctaaac tcaaattaca atggtaatgg catactcaat aagggtggtg     15180
     tcttaggact tgttaaagag tattacaaga agtctgacgt cggaagataa ggcagactgt     15240
     gtcgtgtaca tcatccaata taactatata tataactgtt tcctttcttt ttcgtattta     15300
     cctaaatgca tatattattc agttcccact aattttgtac tacaataata agagaatccc     15360
     ttccctgttt tagaaatgag tagttctttt ctttttcata aataatacag ttgtctctga     15420
     gaagcctaat aagaaaaaaa gaggttaata aattattatt attggttatt tctttccgcc     15480
     acgtagtttt ctttctcttt catacttgtt tttttccgca ccttcttcgg tattaatagt     15540
     gttaacaata tgagccatct ttgcatggta gtcgctgctc tccttgttct tttcttcaat     15600
     tctttgtcta gcttcaaatt tggcgtcttt acggatttct ttcatagtga atttacgttc     15660
     cttctttagt tgggccttca tcttatttat ctcacttctt gttctatcag gatcgtacga     15720
     ttttttatca ggattgaagt tttcttcgta tttaggagca tgcgtaggta tggatacggg     15780
     tttgtggttc tgtaaagcca acggaatatg ttctgtgaat ttcgttaatt tttcaacttt     15840
     gttcaaaata tttcttggct tttcaaaatc agaatacttt gaggtgtatg cacttaataa     15900
     ctgctgaatc ggtaaaataa tttcattgaa agcaggtaag ctcttccaca cagtagagat     15960
     agttgcatct aaagattcca taacatttag taaaacggag acacattgat caaccggatg     16020
     tgcctcggta tccattgttg acaaggtatg taatggaata atagttgatc tcttttttgt     16080
     aaagtcaacg tccaatggaa gccccaactc gtaagagtct agtctaatat tttcaaaatc     16140
     taatggtttt tcttgatttt ctttctcaac tataaaagtg agtaatattt tttgaaagaa     16200
     gtaaaccacc tccggtatgt accgtttgga aatgcgttga tattgtgaaa caatccttac     16260
     caagacagcg ccaaaagcta tcctctttaa agaattaaac ttgatttgtt ccaggaactg     16320
     gctcattaaa atcaatgctg gagttattac taaatggtac tggtccgagg tggagaaaag     16380
     aataccaata atggaaaaaa ataccagatc accatttgat agagcatcaa aatggttctt     16440
     tttatagcgt gcttgcattt cattgatata atctctacac tcctcggaaa gctctctatt     16500
     atatttctct gaaagggatt ttagaattga gatcaatgca ttttgtgtac gtttaaaact     16560
     ttgaacgttt ttaaggtagt tttgattgct tagaaaaatg atgtgtctca gtaaaacagc     16620
     ggtgaatttt cctaactttt ccttattacc ttcagccaat tttggttggt aagctttgat     16680
     aatattctta acaatcttag gatgatcatc taagtctaat ttttttactt gatctaataa     16740
     cgcatcatga gttctagggc atgaaatgga aatgttcttt ttctttaaaa tttgagaaaa     16800
     cccttcatct ctgccttgat cttcaaattt gatatcatca tcagaatcag caataccgtc     16860
     attatcgtct tcatagtctt cttcattttc ccagaatcca tcatccaaat cctctactcc     16920
     tctttcttcg ccttcttcta attcaatcat accgttcata cgatcaagac gctgttgttc     16980
     caactcccgt tttttttctt cagcttcagc gtttttctcc tcttcagttt tagttctatc     17040
     agagggtgca gctcttttgt ccaattgtag ttctttcact ttgatatcat actccttatc     17100
     tagatcggtc ttaggttcca ttggattctt cttgggttgc gtcatcatca attcagacat     17160
     aacatcctcg aaattatcat ccagattatc tatttgatct tccattatac cttgagcctt     17220
     ttgtctttct tgtttgtaaa attttgattt ggcaatgacc tctttcatga cttcagcttt     17280
     ggtttttttt ctttgaggtt gctgtagctc agcatcatct tcattgaatc gtttggaagc     17340
     taaaaaatcc tcttcatcat tggcaagctc atcttctagg gacagcgatt gacctaaatg     17400
     tgtaagaccg tctccaaaca tgtcaccgtc gtcttcatcg tcttcaagat tgaataaatt     17460
     tgcgtttctc tttgattggc tttgtctttc tctggtgaaa cgttccaaca ttttttcttc     17520
     ttccgtcaac aacttgtctc tttcaccaaa tctcttatcg atcacaccac cacgtttatt     17580
     cttcatcatt tttcttgctt caaatgcacg ctttctttgt tcttcaccga tctgtttaga     17640
     gataccaggc ttacccacag caatacgatc agcagtttta gaaggcagac catctctcct     17700
     cttattcctt gcagccttta tttcaaacgg attaaactct tctctgattt cagcaatggc     17760
     cttttttttt tcttcacgat catactcctt cgcttgtctt ttggaattct ttttattctt     17820
     acttttgacg tttgtttgac ctgtgagtcc acgggccttc aaggcggcct ttaaattctt     17880
     aagttgtgaa ccggccatgt atttgatctt cccttttatt tgcttctcaa ctgtactatt     17940
     tacagtaata attagtgcaa ccttcagatg cttctcgcta aatgctcatc tctaaattat     18000
     cattattatt cctaataaat cctaaaattt ttcactcgtt ctgtacggct catcgcccca     18060
     atattacccg tcttgtatgt gatctttttg acttttcggt ggcaaaatgc aaaggggaat     18120
     ccaaggaaaa accataacag gacactacat cagagataat cttgaattaa gagagtagag     18180
     gaatatactg ctgggctcac taccattttt gttgctagag taaacgtaga gaaagatgtc     18240
     aagagatgca ccaattaagg ctgacaagga ttatagccaa attttgaagg aagagtttcc     18300
     taagatcgat tcgctcgctc aaaatgattg taactctgct ttagaccaac tgttagtgtt     18360
     ggagaagaaa accagacaag cttcagatct ggcctcctcg aaagaagttt tggccaagat     18420
     tgtagatctg ctagcatcaa ggaataagtg ggacgaccta aatgagcaat tgactctact     18480
     ctcaaaaaag catggtcagt tgaaattgtc aattcagtat atgatacaaa aggttatgga     18540
     atatttgaaa agctcgaaat ctttggattt aaacaccaga attagtgtca ttgaaactat     18600
     cagggtggtt acagagaaca aaatatttgt agaagtggaa agagctaggg tcaccaaaga     18660
     tttggtggaa attaagaaag aagagggtaa gattgatgaa gctgcagaca tcttgtgtga     18720
     gttacaggtt gagacctatg gctccatgga aatgtctgag aaaattcagt ttatattaga     18780
     gcaaatggaa ttgagtatat taaaaggtga ttattcccaa gccacggtgc tttcaagaaa     18840
     aattctgaaa aaaactttta aaaatccaaa atacgagtca ttgaagctag aatattataa     18900
     tcttctggta aaaattagtt tgcacaagag agaataccta gaagttgcgc agtatctgca     18960
     agaaatttat caaacagacg ccattaaatc agatgaggct aagtggaaac ctgttttatc     19020
     gcacattgta tatttcttag tcctttcacc ttacggcaat ttacaaaatg atttaattca     19080
     caaaatccag aatgataaca acctgaaaaa attagaaagc caagaatctt tagtaaaatt     19140
     gtttactacg aatgagttga tgagatggcc aattgttcaa aaaacctatg agcccgtctt     19200
     aaatgaggat gatttggcat ttggtggaga agctaataag catcactggg aagatttaca     19260
     aaaaagggtc atcgagcaca atttaagagt catttccgaa tactattcca gaattacttt     19320
     actaagattg aatgaattgc tggacctaac ggagagccag acggaaacat acatcagtga     19380
     tttggtaaac cagggcatca tatacgctaa agttaatcgc ccagccaaaa tcgtgaattt     19440
     tgaaaaacca aaaaactcaa gccaattatt gaacgaatgg tcacataatg ttgacgaact     19500
     attagaacat atagaaacaa taggccattt aattacaaaa gaggaaatca tgcacggttt     19560
     gcaagctaaa tgaagagatt ttcgagtaag tgtcggatta tctcagatcc ggttttgatt     19620
     ttaaatctgt tactaatcga aatgtgtatt tacgtacgtg agataaaatt atctatgcat     19680
     atatataact caaatggaaa atggccacgt attgctctca ttctcttcac ttgcttacac     19740
     aaaacataag gtgacaatta atggaatttt agtttttcaa tttttcaggg gaaagaagac     19800
     acccaaaaaa aaagtgaaaa gtcaaaacgg taaactgttt atggtattta aatgacatta     19860
     atagcagcgt aaagagtcat tttttcgttt gattagcaaa actctgaaca ttaattacta     19920
     cacctataga catatcttta aacagtgaaa tatttttttc atttagtaaa caagaattaa     19980
     actttgaata tttttttttc gattaactta tgtcacttta gcctatactt tcttcgaaca     20040
     tttttccttt cattttgact catgatatta gatccattat ctccaaatat tgaaaatcat     20100
     actcaagatg aaataattga gttttgggaa aaaactgagt ctattgctaa cataccaaag     20160
     gaaaacttgg atgaatccca tgttaactca agcctggttg cctacctgaa gtttgctact     20220
     gattcctata aggtttttat taatactgat cgtgacctct accggatgtc gctaatactg     20280
     ttagaatcgt ccttatttga atttaaaaaa gagttttgcc taagtaagtt gcagtcgtta     20340
     ctcaacatag acctactgga aatgaatatg aagttcatta ttgtttacat tcttctctgt     20400
     gaggcgaaaa aaaacgtgta ctccttagaa atcatgctca agttccaagg atttactgtg     20460
     ttttataata ccttgtacac acaattcgcc tatttgagca aatacggaaa ggaaaggaca     20520
     gttgcttcta aacatcaata caattctaat aattctagca caggtacatc cttggacagt     20580
     ttagaccgaa gtttgactga tattgatttg ggtattatag acgaaatgaa gcaaatttca     20640
     actgttttga tggatttgtt atttcaaatt atgaagtact gtaagtgtgt tattgctaat     20700
     cttcaaattg tggatgactt ttttgtttac tatatgatgg aatcaatgag gtccgacact     20760
     atggacgata tgttcaataa cgcggagttt aaactgctgt tggcgttgaa cgaacaatat     20820
     atgatgtttg ccaaggagta cgacattgag aacaaggtct ataagtattt gatcaatggg     20880
     tctgtctcaa gatgttttac ggagctatta ttactgaaat tcaatagggc atcggaccct     20940
     ccgttacaaa ttatgatgtg caaaattatt tatcttatct tgacaccaag aggagactac     21000
     tctccgatga atttctttta tacaaacgac ttacgtgttc ttatcgatgt attaatcaga     21060
     gaactacaga atatcagtga ggatgaagag gtattgagaa acacccttct aagggttctg     21120
     attccgctat taaagaatac acaattatcc aaaacacatt atagaaagga tgatttgaat     21180
     aaactattaa actacttgtc gactttagat aatatatgcg ttgacagtcc agcgttgcac     21240
     gagcatcaag ttacagtggc cttatctcgg aagtgtcttc aacaaattcc ttggttagag     21300
     acaccttcaa cgccttcaga tggaggttca tcggtctcta gtaataacac tagtagaaac     21360
     tctagcattg ttgcattggg gacgcccgac aatcaaaata tcttggctcg taaaggccat     21420
     ctttatagta atcgtgaatt agatgtttct gcagaatctt tgactaaaag aaaggctaaa     21480
     gctccgcctc cgcctcctcc tcctcctcca tcaagaaaat gtggaactcc aaaataagta     21540
     aagcattatt tcttcttgca ttaatgtggt tcttccgacc atttcttctt ctactcactg     21600
     cagtatctaa tgacacattg tactttttat atacaaatgc aacaatcgta actataaaac     21660
     taaagttcgg gttgcttccg aatacatgct ggcagaattt caggttgtgt gtcacttgtt     21720
     aaaataggcg atatttttta ttttagaagt tgtatataac tgttaattac atagtcagtt     21780
     tttttttttc actatcatat tgtttagatt aaaaggactt gtcacatgaa atttaggtcg     21840
     agcagaatac aatcccgaga aaatcaatag gcaaaatagc atttatacac gtattcttaa     21900
     tccggatgca ggtgcaccga tcttagaaat catagcaatt ctatctattt tatctttttc     21960
     cgtgataacg tatttactac ctgttaatgg gtcagaaacg gaaggtgtat cttcataaat     22020
     tggtttgtag gtggctgcac aaatatcgaa tttagcataa ggatcaaagt caattggaat     22080
     ggcgtcactg gccattgagt cggctttgtt tttgatttta cgtgcttgtt ctgcacgagg     22140
     accagaagaa ataatcttta aaaattcacc ggcaaaatat gaggcctgta agaaattttt     22200
     gtgtttgaaa tgttgggaca tagccacttg taaagcattg gtacgatgaa ttggggatag     22260
     ttttgccttt gtaaagtatg cagctagctc aagcatgcgt acagtatttc cctcctttaa     22320
     tgagcggcgt tccaattcaa tggataaacc taatatatac tccctagcag tttccagtat     22380
     cttgtgtgct aatttttcat cttcagcatc atcgaccatt aatagcgtaa tacggtagat     22440
     agcttctctg aagcattcga ttgcaatatc tggtttgttt agtttaaagt ttttgtaacc     22500
     ctcattcatt ttttcattaa cgacatcaag acctggcacg taaggaagaa tttgatcttc     22560
     acttacggta tcatcatacg ctctgacata acctaattga gcaggaagtt cacagggcgt     22620
     actaggaatg tatgttctac aaccctcata aatgttggta aaatatttct tcaatggctc     22680
     cagcttgact acacccactt gcttgctcaa ggcttgaaca gcggcatcaa aggcaccagc     22740
     ggcaactagg acagcaggca gtttagaatt cttgatccaa atggctgttt caacttcctg     22800
     tgctggagag gtaatttcgc cttgctcaac ttcttcaggt aactcttctc ccacatccaa     22860
     atcttcgtca cccaaatccc aggcaccttc gtcttcacca atatcctcat cgttaaagtt     22920
     ttcttcgcct agtggttctt cttgctcttg agtggtgttt actgctggag tttcatcgtc     22980
     tatagtcaaa tcgtcaattt gacctaaaac agccttttca aagtaagata gttcagcctc     23040
     ttttaatggc catttttcaa gtggctttga gatcactggt ctttgaacga agttgg         23096
//

If you have problems or comments...

PBIL Back to PBIL home page