(data stored in SCRATCH zone)

EMBL: Y00811

ID   Y00811; SV 1; linear; mRNA; STD; HUM; 2557 BP.
XX
AC   Y00811;
XX
DT   23-AUG-1988 (Rel. 17, Created)
DT   12-SEP-1993 (Rel. 36, Last updated, Version 2)
XX
DE   Human mRNA for common acute lymphocytic leukemia antigen CALLA (EC
DE   3.4.24.11)
XX
KW   antigen; common acute lymphocytic leukemia antigen; glycoprotein;
KW   metal binding protein; neutral endopeptidase; zinc finger protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2557
RA   Jongeneel C.V.;
RT   ;
RL   Submitted (11-AUG-1988) to the INSDC.
RL   Jongeneel C.V., Ludwig Institute for Cancer Research, Lausanne Branch,
RL   Chemin des Boveresses, CH-1066 Epalinges, Switzerland.
XX
RN   [2]
RX   DOI; 10.1084/jem.168.4.1247.
RX   PUBMED; 2971756.
RA   Letarte M., Vera S., Tran R., Addis J.B.L., Onizuka R.J., Quackenbush E.J.,
RA   Jongeneel C.V., McInnes R.R.;
RT   "Common acute lymphocytic leukemia antigen is identical to neutral
RT   endopeptidase";
RL   J. Exp. Med. 168(4):1247-1253(1988).
XX
DR   MD5; c4bb0657e646554e560efe248c99d3fe.
DR   Ensembl-Gn; ENSG00000196549; homo_sapiens.
DR   Ensembl-Tr; ENST00000360490; homo_sapiens.
DR   Ensembl-Tr; ENST00000460393; homo_sapiens.
DR   Ensembl-Tr; ENST00000462745; homo_sapiens.
DR   Ensembl-Tr; ENST00000492661; homo_sapiens.
DR   Ensembl-Tr; ENST00000493237; homo_sapiens.
DR   Ensembl-Tr; ENST00000615825; homo_sapiens.
XX
CC   Data kindly reviewed (31-AUG-1988) by Jongeneel C.V.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2557
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt11"
FT                   /clone="45"
FT                   /cell_type="cortex"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        136..2388
FT                   /note="CALLA protein (AA 1 - 750)"
FT                   /db_xref="GOA:P08473"
FT                   /db_xref="H-InvDB:HIT000325326.14"
FT                   /db_xref="HGNC:HGNC:7154"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029727"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="PDB:1DL9"
FT                   /db_xref="PDB:1DMT"
FT                   /db_xref="PDB:1QVD"
FT                   /db_xref="PDB:1R1H"
FT                   /db_xref="PDB:1R1I"
FT                   /db_xref="PDB:1R1J"
FT                   /db_xref="PDB:1Y8J"
FT                   /db_xref="PDB:2QPJ"
FT                   /db_xref="PDB:2YB9"
FT                   /db_xref="PDB:4CTH"
FT                   /db_xref="PDB:5JMY"
FT                   /db_xref="PDB:6GID"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08473"
FT                   /protein_id="CAA68752.1"
FT                   /translation="MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   GNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPD
FT                   IYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEK
FT                   EIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITN
FT                   EEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW"
FT   misc_feature    220..288
FT                   /note="transmembrane domain"
FT   misc_feature    220..288
FT                   /note="transmembrane domain"
FT   misc_feature    568..577
FT                   /note="pot. N-linked glycosylation site"
FT   misc_feature    988..997
FT                   /note="pot. N-linked glycosylation site"
FT   misc_feature    1066..1075
FT                   /note="pot. N-linked glycosylation site"
FT   misc_feature    1108..1117
FT                   /note="pot. N-linked glycosylation site"
FT   misc_feature    1139..1148
FT                   /note="pot. N-linked glycosylation site"
FT   misc_feature    1885..1899
FT                   /note="metal binding domain"
FT   misc_feature    2017..2026
FT                   /note="pot. N-linked glycosylation site"
XX
SQ   Sequence 2557 BP; 820 A; 505 C; 596 G; 636 T; 0 other;
     ggcggctgcc gggaggtgcg ctgagcaggg tccgcagcta aggtccagcg cgatccgagc        60
     gcccaggacc ctgcggccgt ggaggaggcg tgccctggga aggagccgct actgggacct       120
     gaagaatttt aggtgatggg caagtcagaa agtcagatgg atataactga tatcaacact       180
     ccaaagccaa agaagaaaca gcgatggact ccactggaga tcagcctctc ggtccttgtc       240
     ctgctcctca ccatcatagc tgtgacaatg atcgcactct atgcaaccta cgatgatggt       300
     atttgcaagt catcagactg cataaaatca gctgctcgac tgatccaaaa catggatgcc       360
     accactgagc cttgtacaga ctttttcaaa tatgcttgcg gaggctggtt gaaacgtaat       420
     gtcattcccg agaccagctc ccgttacggc aactttgaca ttttaagaga tgaactagaa       480
     gtcgttttga aagatgtcct tcaagaaccc aaaactgaag atatagtagc agtgcagaaa       540
     gcaaaagcat tgtacaggtc ttgtataaat gaatctgcta ttgatagcag aggtggagaa       600
     cctctactca aactgttacc agacatatat gggtggccag tagcaacaga aaactgggag       660
     caaaaatatg gtgcttcttg gacagctgaa aaagctattg cacaactgaa ttctaaatat       720
     gggaaaaaag tccttattaa tttgtttgtt ggcactgatg ataagaattc tgtgaatcat       780
     gtaattcata ttgaccaacc tcgacttggc ctcccttcta gagattacta tgaatgcact       840
     ggaatctata aagaggcttg tacagcatat gtggatttta tgatttctgt ggccagattg       900
     attcgtcagg aagaaagatt gcccatcgat gaaaaccagc ttgctttgga aatgaataaa       960
     gttatggaat tggaaaaaga aattgccaat gctacggcta aacctgaaga tcgaaatgat      1020
     ccaatgcttc tgtataacaa gatgacattg gcccagatcc aaaataactt ttcactagag      1080
     atcaatggga agccattcag ctggttgaat ttcacaaatg aaatcatgtc aactgtgaat      1140
     attagtatta caaatgagga agatgtggtt gtttatgctc cagaatattt aaccaaactt      1200
     aagcccattc ttaccaaata ttctgccaga gatcttcaaa atttaatgtc ctggagattc      1260
     ataatggatc ttgtaagcag cctcagccga acctacaagg agtccagaaa tgctttccgc      1320
     aaggcccttt atggtacaac ctcagaaaca gcaacttgga gacgttgtgc aaactatgtc      1380
     aatgggaata tggaaaatgc tgtggggagg ctttatgtgg aagcagcatt tgctggagag      1440
     agtaaacatg tggtcgagga tttgattgca cagatccgag aagtttttat tcagacttta      1500
     gatgacctca cttggatgga tgccgagaca aaaaagagag ctgaagaaaa ggccttagca      1560
     attaaagaaa ggatcggcta tcctgatgac attgtttcaa atgataacaa actgaataat      1620
     gagtacctcg agttgaacta caaagaagat gaatacttcg agaacataat tcaaaatttg      1680
     aaattcagcc aaagtaaaca actgaagaag ctccgagaaa aggtggacaa agatgagtgg      1740
     ataagtggag cagctgtagt caatgcattt tactcttcag gaagaaatca gatagtcttc      1800
     ccagccggca ttctgcagcc ccccttcttt agtgcccagc agtccaactc attgaactat      1860
     gggggcatcg gcatggtcat aggacacgaa atcacccatg gcttcgatga caatggcaga      1920
     aactttaaca aagatggaga cctcgttgac tggtggactc aacagtctgc aagtaacttt      1980
     aaggagcaat cccagtgcat ggtgtatcag tatggaaact tttcctggga cctggcaggt      2040
     ggacagcacc ttaatggaat taatacactg ggagaaaaca ttgctgataa tggaggtctt      2100
     ggtcaagcat acagagccta tcagaattat attaaaaaga atggcgaaga aaaattactt      2160
     cctggacttg acctaaatca caaacaacta tttttcttga actttgcaca ggtgtggtgt      2220
     ggaacctata ggccagagta tgcggttaac tccattaaaa cagatgtgca cagtccaggc      2280
     aatttcagga ttattgggac tttgcagaac tctgcagagt tttcagaagc ctttcactgc      2340
     cgcaagaatt catacatgaa tccagaaaag aagtgccggg tttggtgatc ttcaaaagaa      2400
     gcattgcagc ccttggctag acttgccaac accacagaaa tggggaattc tctaatcgaa      2460
     agaaaatggg ccctaggggt cactgtactg acttgagggt gattaacaga gagggcacca      2520
     tcacaataca gataacatta ggttgtccta gaaaggg                               2557
//

If you have problems or comments...

PBIL Back to PBIL home page