(data stored in ACNUC30567 zone)

EMBL: Y11491

ID   Y11491; SV 1; linear; mRNA; STD; ROD; 608 BP.
XX
AC   Y11491;
XX
DT   27-FEB-1997 (Rel. 51, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 10)
XX
DE   R.norvegicus mRNA for tMDC V protein, partial
XX
KW   cysteine-like protein; disintegrin-like protein;
KW   metalloproteinase-like protein; tMDC V gene; transmembrane protein.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RX   DOI; 10.1002/(SICI)1098-2795(199710)48:2<159::AID-MRD3>3.3.CO;2-L.
RX   PUBMED; 9291465.
RA   Frayne J., Jury J.A., Barker H.L., Hall L.;
RT   "Rat MDC family of proteins: sequence analysis, tissue distribution, and
RT   expression in prepubertal and adult rat testis";
RL   Mol. Reprod. Dev. 48(2):159-167(1997).
XX
RN   [2]
RP   1-608
RA   Hall L.;
RT   ;
RL   Submitted (24-FEB-1997) to the INSDC.
RL   L. Hall, Dept. of Biochemistry, Univ. of Bristol, School of Medical
RL   Sciences, Univ.Walk, Bristol, BS8 1TD, UK
XX
DR   MD5; 6e06b1089a675304784cd64c274aea2f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..608
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague Dawley"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        <1..>608
FT                   /codon_start=1
FT                   /product="tMDC V"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR033959"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="UniProtKB/TrEMBL:P97777"
FT                   /protein_id="CAA72277.1"
FT                   /translation="MSEFPTLLDMMSNCSHHNLHEKIIGWDACLSQPRVAYKNFKYAVP
FT                   RCGNKVVDDNEQCDCGTLKDCLSNHCCGTNCQLIGSSTCAEGLCCQSCRFAPTGKVCRH
FT                   TNGICDLPEYCSGVSEHCPQNFYIMDGTPCSPLAVCMSGNCSDRQLQCQALFGYHVKDA
FT                   SPACYKELNTKGDRFGNCGVREVRGGSKPLACQEEDIFCG"
XX
SQ   Sequence 608 BP; 169 A; 114 C; 150 G; 175 T; 0 other;
     atgagtgaat ttcctactct tctggacatg atgagcaatt gttcccatca taatctacat        60
     gagaagatca ttggttggga cgcttgcttg agtcaaccgc gggttgcata taagaatttc       120
     aaatatgcag ttcctcgttg tggaaataag gtagtggatg acaatgagca atgtgactgt       180
     ggtactttaa aagactgtct ctctaatcac tgttgtggaa ccaattgtca gttaattggg       240
     agcagcactt gtgctgaagg actttgttgt caatcttgta ggtttgcacc cactggaaag       300
     gtatgcaggc acacgaatgg catttgtgat cttccagaat actgtagtgg agtctcagag       360
     cattgcccac aaaatttcta catcatggat ggaacccctt gttctccact agcagtctgc       420
     atgtcaggaa actgtagcga ccgccaattg cagtgtcaag ctctttttgg ataccatgta       480
     aaggatgctt caccagcatg ctataaagaa ttaaatacca aaggtgaccg atttggaaac       540
     tgtggggtta gagaggtacg tggaggaagt aaacctctcg catgtcaaga ggaggatatt       600
     ttctgtgg                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page