(data stored in ACNUC16935 zone)

EMBL: Z17774

ID   Z17774; SV 1; linear; mRNA; EST; PLN; 333 BP.
XX
AC   Z17774;
XX
DT   01-NOV-1992 (Rel. 33, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   A. thaliana transcribed sequence; clone YAP298T7, 3' end; similar to
DE   Arabidopsis polyubiquitin.
XX
KW   expressed sequence tag; partial cDNA sequence.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-333
RA   Raynal M., Grellet F., Laudie M., Meyer Y., Cooke R., Delseny M.;
RT   ;
RL   Submitted (31-OCT-1992) to the INSDC.
RL   CNRS, GDR-1003 ACS, INRA, laboratoire de Biologie Moleculaire, BP 27, 31326
RL   Castanet-Tolosan cedex, France. E-mail:gdr-svp@toulouse.inra.fr. On behalf
RL   of: Laboratoire de Physiologie et Biologie Moleculaires Vegetales, URA CNRS
RL   565, Universite de Perpignan, Avenue de Villeneuve, 66860 Perpignan Cedex,
RL   France. E-mail:raynal@univ-perp.fr.
XX
RN   [2]
RP   1-333
RA   CNRS;
RT   "The Arabidopsis thaliana transcribed genome: the GDR cDNA program";
RL   Unpublished.
XX
DR   MD5; 47fe1cfd671dd92551c52364ed281796.
DR   UNILIB; 192; 24.
XX
CC   Cloning vector: Lambda ZAPII non-oriented.
CC
CC   full automatic.
CC
CC   similarity detected by FASTA against EMBL entry X12853.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..333
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Gif-SeedA+B"
FT                   /clone="YAP298T7"
FT                   /tissue_type="Green siliques of A.thaliana ecotype
FT                   columbia"
FT                   /db_xref="taxon:3702"
FT                   /db_xref="UNILIB:192"
FT   CDS_pept        <1..117
FT                   /codon_start=1
FT                   /product="polyubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q41930"
FT                   /protein_id="CAA79061.1"
FT                   /translation="QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGSF"
XX
SQ   Sequence 333 BP; 71 A; 67 C; 73 G; 122 T; 0 other;
     cagagactca tcttcgctgg aaaacagctt gaggatggtc gcacacttgc agattacaac        60
     atccagaagg agtcgactct tcacttggtt cttcgtcttc gtggtggaag cttctaagct       120
     ttttgtgatc tgatgataag tggttggttc gtgtctcatg cacttgggag gtgatctatt       180
     tcacctggtg tagtttgagt ttccgtcagt tggaaaaact tatccctatc gatttcgttt       240
     tcattttctg cttttctttt atgtaccttc gtttgggctt gtaacgggcc tttgtatttc       300
     aactctcaat aataatccaa gtgcatgtta aac                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page