(data stored in ACNUC16935 zone)

EMBL: Z29165

ID   Z29165; SV 1; linear; mRNA; EST; PLN; 314 BP.
XX
AC   Z29165;
XX
DT   02-JAN-1994 (Rel. 38, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   A. thaliana transcribed sequence; clone VBVRH11; similar to Ubiquitin
DE   precursor; Linum usitatissimum.
XX
KW   expressed sequence tag; partial cDNA sequence.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-314
RA   Desprez T., Amselem J., Chiapello H., Caboche M., Hofte H.;
RT   ;
RL   Submitted (02-JAN-1994) to the INSDC.
RL   CNRS, GDR-1003 ACS, INRA, laboratoire de Biologie Moleculaire, BP 27, 31326
RL   Castanet-Tolosan cedex, France. E-mail:gdr-svp@toulouse.inra.fr. On behalf
RL   of: INRA Versailles, Laboratoire de Biologie Cellulaire, Route de
RL   Saint-Cyr, 78026 Versailles Cedex, France.
RL   E-mail:thierry@versailles.inra.fr.
XX
RN   [2]
RP   1-314
RA   CNRS;
RT   "The Arabidopsis thaliana transcribed genome: the GDR cDNA program";
RL   Unpublished.
XX
DR   MD5; 61acf7ceee9a3f034b4379e821d14ab4.
DR   UNILIB; 196; 29.
XX
CC   Cloning vector: pBluescript (Stratagene);
CC   Physiological conditions: in vitro-grown etiolated seedlings,
CC                             5 days old.
CC
CC   full automatic.
CC
CC   similarity detected by BlastX against PIR entry PS0428.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..314
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Versailles-VB"
FT                   /clone="VBVRH11"
FT                   /tissue_type="whole seedlings of A. thaliana ecotype
FT                   Columbia"
FT                   /db_xref="taxon:3702"
FT                   /db_xref="UNILIB:196"
FT   CDS_pept        <1..>314
FT                   /codon_start=3
FT                   /product="Ubiquitin precursor"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q42214"
FT                   /protein_id="CAA82404.1"
FT                   /translation="STLHLVLRLRGGMQIFLXXATGKTITLEVESSDTIXNVKAKIQDK
FT                   EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLLXGMQIFVKTLTGKTITLE
FT                   "
XX
SQ   Sequence 314 BP; 81 A; 73 C; 78 G; 75 T; 7 other;
     aatccaccct ccacttggtt ctnaggctcc gtggtggtat gcagattttc ttananncng        60
     ccacgggaaa gacgattact cttgaggtgg agagctctga caccattnac aacgtcaagg       120
     ccaagatcca agataaggag ggtattcctc cggaccagca gaggttgatc ttcgccggaa       180
     agcaacttga ggacggcaga actttggcgg attacaacat ccagaaggag tctacgcttc       240
     atttggtctt gcgtctgctt ngaggtatgc agatcttcgt aaagactttg accggaaaga       300
     ccatcactct tgaa                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page